Zu "GeneID 9033" wurden 15 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-PKD2L1
Anti-PKD2L1

Artikelnummer: ATA-HPA070002.100

Polyclonal Antibody against Human PKD2L1, Gene description: polycystin 2 like 1, transient receptor potential cation channel, Alternative Gene Names: PCL, PKD2L, PKDL, TRPP3, Validated applications: ICC, Uniprot ID: Q9P0L9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C....
Schlagworte: Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney...
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
477,00 €
Bewerten
Anti-PKD2L1
Anti-PKD2L1

Artikelnummer: CSB-PA214505.100

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: PKD2L1. Antigen Species: Human
Schlagworte: Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney...
Anwendung: ELISA, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-PKD2L1
Anti-PKD2L1

Artikelnummer: CSB-PA960366.100

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: PKD2L1. Antigen Species: Human
Schlagworte: Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney...
Anwendung: ELISA, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
NEU
Nanodisc Human PK2L1-Strep Protein
Nanodisc Human PK2L1-Strep Protein

Artikelnummer: G-HDFP1396.10

Protein function: Pore-forming subunit of a heterotetrameric, non-selective cation channel that is permeable to Ca(2+) (PubMed:10517637, PubMed:11959145, PubMed:25820328, PubMed:27754867, PubMed:29425510, PubMed:23212381, PubMed:30004384). Pore-forming subunit of a calcium- permeant ion channel formed by PKD1L2 and...
Schlagworte: PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein
Exprimiert in: Human cells
Ursprungsart: human
1.336,00 €
Bewerten
NEU
Nanodisc Human PK2L1 Protein
Nanodisc Human PK2L1 Protein

Artikelnummer: G-HDFP681.10

Protein function: Pore-forming subunit of a heterotetrameric, non-selective cation channel that is permeable to Ca(2+) (PubMed:10517637, PubMed:11959145, PubMed:25820328, PubMed:27754867, PubMed:29425510, PubMed:23212381, PubMed:30004384). Pore-forming subunit of a calcium- permeant ion channel formed by PKD1L2 and...
Schlagworte: PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein
Exprimiert in: Human cells
Ursprungsart: human
1.486,00 €
Bewerten
Human PK2L1 full length protein-synthetic nanodisc
Human PK2L1 full length protein-synthetic nanodisc

Artikelnummer: DIM-FLP100773.10

This gene encodes a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation...
Schlagworte: PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein
Anwendung: Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization
Exprimiert in: Human cells
Ursprungsart: human
MW: 92 kD
ab 1.291,00 €
Bewerten
Human PK2L1-Strep full length protein-synthetic nanodisc
Human PK2L1-Strep full length protein-synthetic nanodisc

Artikelnummer: DIM-FLP120773.10

This gene encodes a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation...
Schlagworte: PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein
Anwendung: Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization
Exprimiert in: Human cells
Ursprungsart: human
MW: 92 kD
ab 1.162,00 €
Bewerten
PKD2L1 (human), recombinant protein
PKD2L1 (human), recombinant protein

Artikelnummer: ABS-PP-5501.100

Schlagworte: Polycystin-2-like protein 1, Polycystin-2L1, Polycystic kidney disease 2-like 1 protein, Polycystin-2 homolog,...
MW: 29.5 kD
ab 90,00 €
Bewerten
PKD2L1 PrEST Antigen
PKD2L1 PrEST Antigen

Artikelnummer: ATA-APrEST96085.100

PrEST Antigen PKD2L1, Gene description: polycystin 2 like 1, transient receptor potential cation channel, Alternative Gene Names: PCL, PKD2L, PKDL, TRPP3, Antigen sequence: YNKTLLRLRLRKERVSDVQKVLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
Schlagworte: PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein
Exprimiert in: E.coli
Ursprungsart: human
265,00 €
Bewerten
Anti-PKD2L1
Anti-PKD2L1

Artikelnummer: CSB-PA018062GA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PKD2L1. Antigen Species: Human
Schlagworte: Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney...
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
552,00 €
Bewerten
Anti-PKD2L1
Anti-PKD2L1

Artikelnummer: CSB-PA865199DSR2HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PKD2L1. Antigen Species: Human
Schlagworte: Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney...
Anwendung: ELISA, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
PKD2L1 (Vector pUC, Accession No. BC025665)
PKD2L1 (Vector pUC, Accession No. BC025665)

Artikelnummer: CSB-CL865199HU.10

Length: 2418 Sequence: atgaatgctg tgggaagtcc tgaggggcag gagctgcaaa agctggggag tggagcctgg gacaaccccg cctacagtgg tcccccttcc ccacacggga cgctgagagt ctgcaccatc tccagcacgg ggcctctcca gccccaaccc aagaagcctg aagatgaacc ccaggagacg gcatacagga cccaggtgtc cagctgctgc ctccatatct gtcaaggcat cagaggactt tggggaacaa ccctgactga...
Schlagworte: PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
879,00 €
Bewerten
1 von 2 Seiten