- Suchergebnis für GeneID 8911
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 8911" wurden 11 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: G-PACO07169.50
CACNA1I Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, IHC applications. CACNA1I Antibody is a high quality polyclonal antibody for research use only.. Protein function: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions...
| Schlagworte: | Anti-CACNA1I, Anti-KIAA1120, Anti-Ca(v)3.3, Anti-Voltage-gated calcium channel subunit alpha Cav3.3,... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
225,00 €
Artikelnummer: ELK-EA273.50
Voltage-gated Ca2+ channels (CaV), enable the passage of Ca2+ ions in a voltage dependent manner. These heteromeric entities are formed in part by the pore-forming alpha1 subunit which determines the biophysical and pharmacological properties of the channel. Protein function: Voltage-sensitive calcium channels...
| Schlagworte: | Anti-CACNA1I, Anti-Ca(v)3.3, Anti-KIAA1120, Anti-Voltage-gated calcium channel subunit alpha Cav3.3,... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
173,00 €
Artikelnummer: CSB-PA413190.50
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using specific immunogen....
| Schlagworte: | Anti-CACNA1I, Anti-KIAA1120, Anti-Ca(v)3.3, Anti-Voltage-gated calcium channel subunit alpha Cav3.3,... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
126,00 €
Artikelnummer: ATA-HPA066992.100
Polyclonal Antibody against Human CACNA1I, Gene description: calcium voltage-gated channel subunit alpha1 I, Alternative Gene Names: Cav3.3, Validated applications: ICC, Uniprot ID: Q9P0X4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Voltage-sensitive...
| Schlagworte: | Anti-CACNA1I, Anti-KIAA1120, Anti-Ca(v)3.3, Anti-Voltage-gated calcium channel subunit alpha Cav3.3,... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ABS-PP-4567-L.100
Protein function: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. This...
| Schlagworte: | Voltage-dependent T-type calcium channel subunit alpha-1I, Voltage-gated calcium channel subunit alpha Cav3.3, Ca(v)3.3,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 10 kD |
ab 115,00 €
Artikelnummer: G-HDFP652.10
Protein function: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. This...
| Schlagworte: | CACNA1I, KIAA1120, Ca(v)3.3, Voltage-gated calcium channel subunit alpha Cav3.3, Voltage-dependent T-type calcium channel... |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
1.693,00 €
Artikelnummer: VHPS-1453
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | CACNA1I, Ca(v)3.3, KIAA1120, Voltage-gated calcium channel subunit alpha Cav3.3, Voltage-dependent T-type calcium channel... |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: ELK-ES20794.100
calcium voltage-gated channel subunit alpha1 I(CACNA1I) Homo sapiens This gene encodes the pore-forming alpha subunit of a voltage gated calcium channel. The encoded protein is a member of a subfamily of calcium channels referred to as is a low voltage-activated, T-type, calcium channel. The channel encoded by this...
| Schlagworte: | Anti-CACNA1I, Anti-Ca(v)3.3, Anti-KIAA1120, Anti-Voltage-gated calcium channel subunit alpha Cav3.3,... |
| Anwendung: | IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse |
ab 173,00 €
Artikelnummer: ABS-PP-4567.100
Protein function: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. This...
| Schlagworte: | Voltage-dependent T-type calcium channel subunit alpha-1I, Voltage-gated calcium channel subunit alpha Cav3.3, Ca(v)3.3,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 10 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95994.100
PrEST Antigen CACNA1I, Gene description: calcium voltage-gated channel subunit alpha1 I, Alternative Gene Names: Cav3.3, Antigen sequence: HHDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDPTACPPGRKDSKGELDPPEPMRVGDLGECFFPLSSTAVSPDPENFLCEMEEIPFNPVR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Schlagworte: | CACNA1I, KIAA1120, Ca(v)3.3, Voltage-gated calcium channel subunit alpha Cav3.3, Voltage-dependent T-type calcium channel... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: DIM-FLP120744.10
This gene encodes the pore-forming alpha subunit of a voltage gated calcium channel. The encoded protein is a member of a subfamily of calcium channels referred to as is a low voltage-activated, T-type, calcium channel. The channel encoded by this protein is characterized by a slower activation and inactivation...
| Schlagworte: | CACNA1I, KIAA1120, Ca(v)3.3, Voltage-gated calcium channel subunit alpha Cav3.3, Voltage-dependent T-type calcium channel... |
| Anwendung: | Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
| MW: | 245.1 kD |
ab 1.185,00 €