- Suchergebnis für GeneID 8853
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 8853" wurden 9 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: A303-311A
Protein function: Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration. [The UniProt Consortium]
| Schlagworte: | Anti-PAP, Anti-PAG3, Anti-ASAP2, Anti-DDEF2, Anti-Pyk2 C-terminus-associated protein, Anti-Development and... |
| Anwendung: | WB, IP |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 165,00 €
Artikelnummer: ATA-HPA068383.100
Polyclonal Antibody against Human ASAP2, Gene description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 2, Alternative Gene Names: CENTB3, DDEF2, KIAA0400, PAP, SHAG1, Validated applications: ICC, Uniprot ID: O43150, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C....
| Schlagworte: | Anti-PAP, Anti-PAG3, Anti-DDEF2, Anti-ASAP2, Anti-Pyk2 C-terminus-associated protein, Anti-Development and... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ABS-PP-4632-L.100
Protein function: Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration. [The UniProt Consortium]
| Schlagworte: | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2, Development and differentiation-enhancing factor... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 46.5 kD |
ab 115,00 €
Artikelnummer: VHPS-2497
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | PAP, PAG3, DDEF2, ASAP2, Pyk2 C-terminus-associated protein, Development and differentiation-enhancing factor 2,... |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: A3334-96.100
ASAP2 is a multidomain protein belonging to the beta family with two ANK repeats, an Arf-GAP domain, a PH domain and a SH3 domain. This protein localizes in the Golgi apparatus and also at the plasma membrane where it colocalizes with protein tyrosine kinase 2-beta (PYK2) and forms a stable complex with PYK2 in...
| Schlagworte: | Anti-Pyk2 C-terminus-associated protein, Anti-Development and differentiation-enhancing factor 2, Anti-Paxillin-associated... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
667,00 €
Artikelnummer: ELK-ES8991.100
This gene encodes a multidomain protein containing an N-terminal alpha-helical region with a coiled-coil motif, followed by a pleckstrin homology (PH) domain, an Arf-GAP domain, an ankyrin homology region, a proline-rich region, and a C-terminal Src homology 3 (SH3) domain. The protein localizes in the Golgi...
| Schlagworte: | Anti-PAP, Anti-PAG3, Anti-DDEF2, Anti-ASAP2, Anti-Pyk2 C-terminus-associated protein, Anti-Development and... |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
Artikelnummer: CSB-CL002176HU.10
Length: 2886 Sequence: atgccggacc agatctccgt gtcggaattc gtggccgaga cccatgagga ctacaaggcg cccacggcct ccagcttcac cacccgcacg gcgcagtgcc ggaacactgt ggcggccatc gaggaggctt tggacgtgga ccggatggtt ctttacaaaa tgaagaaatc cgtgaaagca atcaacagct ctgggctggc tcacgtggaa aatgaagagc agtacaccca ggctctggag aagtttggcg gcaaccgtgt...
| Schlagworte: | PAP, PAG3, ASAP2, DDEF2, Pyk2 C-terminus-associated protein, Development and differentiation-enhancing factor 2,... |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
1.044,00 €
Artikelnummer: ABS-PP-4632.100
Protein function: Activates the small GTPases ARF1, ARF5 and ARF6. Regulates the formation of post-Golgi vesicles and modulates constitutive secretion. Modulates phagocytosis mediated by Fc gamma receptor and ARF6. Modulates PXN recruitment to focal contacts and cell migration. [The UniProt Consortium]
| Schlagworte: | Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2, Development and differentiation-enhancing factor... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 46.5 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95867.100
PrEST Antigen ASAP2, Gene description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 2, Alternative Gene Names: CENTB3, DDEF2, KIAA0400, PAP, SHAG1, Antigen sequence: WRLLHEDLDESDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKDKQRAFMPSILQNETY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
| Schlagworte: | PAP, PAG3, ASAP2, DDEF2, Pyk2 C-terminus-associated protein, Development and differentiation-enhancing factor 2,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €