Zu "GeneID 84502" wurden 7 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-JPH4
Artikelnummer: 600-401-CC9
Anti-JPH4 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. Cross reactivity with JPH4 from other sources has not been determined. Protein function: Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the...
| Schlagworte: | Anti-JP-4, Anti-JPH4, Anti-JPHL1, Anti-Junctophilin-4, Anti-Junctophilin-like 1 protein |
| Anwendung: | ELISA, IHC, IFM, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
848,00 €
Anti-JPH4
Artikelnummer: 600-401-CD0
Anti-JPH4 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. Cross reactivity with JPH4 from other sources has not been determined. Protein function: Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the...
| Schlagworte: | Anti-JP-4, Anti-JPH4, Anti-JPHL1, Anti-Junctophilin-4, Anti-Junctophilin-like 1 protein |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
848,00 €
Anti-JPH4
Artikelnummer: ATA-HPA045022.100
Polyclonal Antibody against Human JPH4, Gene description: junctophilin 4, Alternative Gene Names: JPHL1, KIAA1831, Validated applications: ICC, Uniprot ID: Q96JJ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Junctophilins contribute to the formation of...
| Schlagworte: | Anti-JP-4, Anti-JPH4, Anti-JPHL1, Anti-Junctophilin-4, Anti-Junctophilin-like 1 protein |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
JPH4 (human), recombinant protein
Artikelnummer: ABS-PP-24831.100
Protein function: Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the endoplasmic or sarcoplasmic reticulum in excitable cells. Provides a structural foundation for functional cross-talk between the cell surface and intracellular calcium release...
| Schlagworte: | JPH4, JP-4, JPHL1, Junctophilin-4, Junctophilin-like 1 protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 10 kD |
ab 90,00 €
JPH4 (human), recombinant protein
Artikelnummer: ABS-PP-24831-L.100
Protein function: Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the endoplasmic or sarcoplasmic reticulum in excitable cells. Provides a structural foundation for functional cross-talk between the cell surface and intracellular calcium release...
| Schlagworte: | JPH4, JP-4, JPHL1, Junctophilin-4, Junctophilin-like 1 protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 10 kD |
ab 115,00 €
JPHL1, Human, Real Time PCR Primer Set
Artikelnummer: VHPS-4706
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | JPH4, JP-4, JPHL1, Junctophilin-4, Junctophilin-like 1 protein |
| Anwendung: | RNA quantification |
45,00 €
JPH4 PrEST Antigen
Artikelnummer: ATA-APrEST95836.100
PrEST Antigen JPH4, Gene description: junctophilin 4, Alternative Gene Names: JPHL1, KIAA1831, Antigen sequence: PSSPASSRQPWRPPACRSPLPPGGDQGPFSSPKAWPEEWGGAGAQAEELAGYEAEDEAGMQGPGPRDGSPLLGGCSDSSGSLREEE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Junctophilins contribute...
| Schlagworte: | JPH4, JP-4, JPHL1, Junctophilin-4, Junctophilin-like 1 protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €