- Suchergebnis für GeneID 84502
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 84502" wurden 7 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: 600-401-CC9
Anti-JPH4 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. Cross reactivity with JPH4 from other sources has not been determined. Protein function: Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the...
| Schlagworte: | Anti-JP-4, Anti-JPH4, Anti-JPHL1, Anti-Junctophilin-4, Anti-Junctophilin-like 1 protein |
| Anwendung: | ELISA, IHC, IFM, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
848,00 €
Artikelnummer: 600-401-CD0
Anti-JPH4 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. Cross reactivity with JPH4 from other sources has not been determined. Protein function: Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the...
| Schlagworte: | Anti-JP-4, Anti-JPH4, Anti-JPHL1, Anti-Junctophilin-4, Anti-Junctophilin-like 1 protein |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
848,00 €
Artikelnummer: ATA-HPA045022.100
Polyclonal Antibody against Human JPH4, Gene description: junctophilin 4, Alternative Gene Names: JPHL1, KIAA1831, Validated applications: ICC, Uniprot ID: Q96JJ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Junctophilins contribute to the formation of...
| Schlagworte: | Anti-JP-4, Anti-JPH4, Anti-JPHL1, Anti-Junctophilin-4, Anti-Junctophilin-like 1 protein |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ABS-PP-24831.100
Protein function: Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the endoplasmic or sarcoplasmic reticulum in excitable cells. Provides a structural foundation for functional cross-talk between the cell surface and intracellular calcium release...
| Schlagworte: | JPH4, JP-4, JPHL1, Junctophilin-4, Junctophilin-like 1 protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 10 kD |
ab 90,00 €
Artikelnummer: ABS-PP-24831-L.100
Protein function: Junctophilins contribute to the formation of junctional membrane complexes (JMCs) which link the plasma membrane with the endoplasmic or sarcoplasmic reticulum in excitable cells. Provides a structural foundation for functional cross-talk between the cell surface and intracellular calcium release...
| Schlagworte: | JPH4, JP-4, JPHL1, Junctophilin-4, Junctophilin-like 1 protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 10 kD |
ab 115,00 €
Artikelnummer: VHPS-4706
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | JPH4, JP-4, JPHL1, Junctophilin-4, Junctophilin-like 1 protein |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: ATA-APrEST95836.100
PrEST Antigen JPH4, Gene description: junctophilin 4, Alternative Gene Names: JPHL1, KIAA1831, Antigen sequence: PSSPASSRQPWRPPACRSPLPPGGDQGPFSSPKAWPEEWGGAGAQAEELAGYEAEDEAGMQGPGPRDGSPLLGGCSDSSGSLREEE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Junctophilins contribute...
| Schlagworte: | JPH4, JP-4, JPHL1, Junctophilin-4, Junctophilin-like 1 protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €