Zu "GeneID 8312" wurden 20 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-AXIN1
Anti-AXIN1

Artikelnummer: ABS-KC-1213.100

Protein function: Component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling (PubMed:12192039, PubMed:27098453). Controls dorsoventral patterning via two opposing effects, down-regulates CTNNB1 to inhibit the Wnt...
Schlagworte: Anti-Axin-1, Anti-Axis inhibition protein 1, Anti-hAxin, AXIN1 Antibody
Wirt: Mouse
Spezies-Reaktivität: human
ab 232,00 €
Bewerten
Anti-AXIN1
Anti-AXIN1

Artikelnummer: ATA-HPA073924.100

Polyclonal Antibody against Human AXIN1, Gene description: axin 1, Alternative Gene Names: PPP1R49, Validated applications: ICC, WB, Uniprot ID: O15169, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Component of the beta-catenin destruction complex...
Schlagworte: Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1
Anwendung: WB, ICC
Wirt: Rabbit
Spezies-Reaktivität: human
450,00 €
Bewerten
Anti-AXIN1
Anti-AXIN1

Artikelnummer: CSB-PA828936.100

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: AXIN1. Antigen Species: Human
Schlagworte: Anti-AXIN, Anti-AXIN1, Anti-hAxin, Anti-Axin-1, Anti-Axis inhibition protein 1, axin 1, AXIN1 Antibody
Anwendung: ELISA, IHC
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
ab 167,00 €
Bewerten
Anti-AXIN1
Anti-AXIN1

Artikelnummer: CSB-PA914369.100

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: AXIN1. Antigen Species: Human
Schlagworte: Anti-AXIN, Anti-AXIN1, Anti-hAxin, Anti-Axin-1, Anti-Axis inhibition protein 1, axin 1, AXIN1 Antibody
Anwendung: ELISA, IHC
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
ab 167,00 €
Bewerten
Anti-AXIN1, C-terminal
Anti-AXIN1, C-terminal

Artikelnummer: ARG63283.100

Protein function: Component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling. Controls dorsoventral patterning via two opposing effects, down-regulates CTNNB1 to inhibit the Wnt signaling pathway and ventralize...
Schlagworte: Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1
Anwendung: ELISA, IHC (paraffin)
Wirt: Goat
Spezies-Reaktivität: human
822,00 €
Bewerten
Human Axin-1 ELISA Kit
Human Axin-1 ELISA Kit

Artikelnummer: G-HUFI02140.96

ELISA Type: Sandwich. Detection Range: 15.625-1000µg/mL. Sensitivity: 9.375µg/mL. Sample Types: Serum, Plasma. Protein function: Component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling (PubMed:12192039,...
Schlagworte: AXIN, AXIN1, hAxin, Axin-1, Axis inhibition protein 1
Anwendung: Sandwich ELISA
Spezies-Reaktivität: human
641,00 €
Bewerten
Anti-AXIN1
Anti-AXIN1

Artikelnummer: NSJ-R34056-100UG

0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: Axis inhibition protein 1 Protein function: Component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating...
Schlagworte: Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1, AXIN1 Antibody
Anwendung: IHC, ELISA (peptide)
Wirt: Goat
Spezies-Reaktivität: human
790,00 €
Bewerten
Anti-AXIN1
Anti-AXIN1

Artikelnummer: NSJ-F45423-0.08ML

In 1X PBS, pH 7.4, with 0.09% sodium azide. AXIN1 is a component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling. Controls dorsoventral patterning via two opposing effects, down-regulates CTNNB1 to inhibit the Wnt...
Schlagworte: Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1, AXIN1 Antibody
Anwendung: WB, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 350,00 €
Bewerten
Anti-Axin-1
Anti-Axin-1

Artikelnummer: NSJ-F41872-0.08ML

In 1X PBS, pH 7.4, with 0.09% sodium azide. Axin-1 is a cytoplasmic protein which contains a regulation of G-protein signaling (RGS) domain and a dishevelled and axin (DIX) domain. The encoded protein interacts with adenomatosis polyposis coli, catenin beta-1, glycogen synthase kinase 3 beta, protein phosphate 2,...
Schlagworte: Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1, Axin-1 Antibody
Anwendung: WB, IHC, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 350,00 €
Bewerten
AXIN1 (human), recombinant protein
AXIN1 (human), recombinant protein

Artikelnummer: ABS-PP-690.100

Schlagworte: Axin-1, Axis inhibition protein 1, hAxin, Recombinant Human AXIN1 Protein
MW: 15.5 kD
ab 90,00 €
Bewerten
AXIN1 PrEST Antigen
AXIN1 PrEST Antigen

Artikelnummer: ATA-APrEST95824.100

PrEST Antigen AXIN1, Gene description: axin 1, Alternative Gene Names: PPP1R49, Antigen sequence: AWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLRTPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of the beta-catenin destruction...
Schlagworte: AXIN, hAxin, AXIN1, Axin-1, Axis inhibition protein 1
Exprimiert in: E.coli
Ursprungsart: human
265,00 €
Bewerten
Anti-AXIN1
Anti-AXIN1

Artikelnummer: CSB-PA517675LA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: AXIN1. Antigen Species: Human
Schlagworte: Anti-AXIN, Anti-AXIN1, Anti-hAxin, Anti-Axin-1, Anti-Axis inhibition protein 1, AI316800 antibody, AXIN antibody, Axin 1...
Anwendung: ELISA, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
1 von 2 Seiten