Zu "GeneID 80712" wurden 12 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ESX1
Anti-ESX1

Artikelnummer: 600-401-BC1

Anti-ESX1 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. Cross reactivity with ESX1 from other sources has not been determined. Protein function: May coordinately regulate cell cycle progression and transcription during spermatogenesis. Inhibits degradation of...
Schlagworte: Anti-ESX1, Anti-ESX1L
Anwendung: ELISA, IHC, IFM, WB
Wirt: Rabbit
Spezies-Reaktivität: human
848,00 €
Bewerten
Anti-ESX1
Anti-ESX1

Artikelnummer: ATA-HPA051992.100

Protein function: May coordinately regulate cell cycle progression and transcription during spermatogenesis. Inhibits degradation of polyubiquitinated cyclin A and cyclin B1 and thereby arrests the cell cycle at early M phase. ESXR1-N acts as a transcriptional repressor. Binds to the sequence 5'-TAATGTTATTA-3' which...
Schlagworte: Anti-ESX1, Anti-ESX1L
Anwendung: ICC, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 369,00 €
Bewerten
Anti-ESX1
Anti-ESX1

Artikelnummer: ATA-HPA073330.100

Polyclonal Antibody against Human ESX1, Gene description: ESX homeobox 1, Alternative Gene Names: ESX1L, ESXR1, Validated applications: IHC, Uniprot ID: Q8N693, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May coordinately regulate cell cycle progression...
Schlagworte: Anti-ESX1, Anti-ESX1L
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
NEU
Anti-ESX1
Anti-ESX1

Artikelnummer: ATA-HPA073330.25

Polyclonal Antibody against Human ESX1, Gene description: ESX homeobox 1, Alternative Gene Names: ESX1L, ESXR1, Validated applications: IHC, Uniprot ID: Q8N693, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May coordinately regulate cell cycle progression...
Schlagworte: Anti-ESX1, Anti-ESX1L
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
361,00 €
Bewerten
ESX1 Antibody
ESX1 Antibody

Artikelnummer: G-PACO09149.100

ESX1 Antibody is a premium polyclonal that offers outstanding performance and reliability for demanding research applications. Rigorously validated for ELISA, WB, this antibody ensures consistent, reproducible results across multiple experimental platforms. Demonstrates excellent reactivity with Human, Mouse...
Schlagworte: Anti-ESX1, Anti-Homeobox protein ESX1, Anti-Extraembryonic, spermatogenesis, homeobox 1
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
1.124,00 €
Bewerten
ESX1 (human), recombinant protein
ESX1 (human), recombinant protein

Artikelnummer: ABS-PP-10621-L.100

Protein function: May coordinately regulate cell cycle progression and transcription during spermatogenesis. Inhibits degradation of polyubiquitinated cyclin A and cyclin B1 and thereby arrests the cell cycle at early M phase. ESXR1-N acts as a transcriptional repressor. Binds to the sequence 5'-TAATGTTATTA-3' which...
Schlagworte: Homeobox protein ESX1, Extraembryonic, spermatogenesis, homeobox 1) [Cleaved into: Homeobox protein ESX1-N, Homeobox...
Exprimiert in: E.coli
Ursprungsart: human
MW: 15 kD
ab 115,00 €
Bewerten
Anti-ESX1, NT (ESX1, ESX1L, ESX1R, Homeobox protein ESX1, Extraembryonic, spermatogenesis, homeobox
Anti-ESX1, NT (ESX1, ESX1L, ESX1R, Homeobox protein ESX1,...

Artikelnummer: 035244.200

This gene encodes a dual-function 65 kDa protein that undergoes proteolytic cleavage to produce a 45 kDa N-terminal fragment with a paired-like homeodomain and a 20 kDa C-terminal fragment with a proline-rich domain. The C-terminal fragment localizes to the cytoplasm while the N-terminal fragment localizes...
Schlagworte: Anti-ESX1, Anti-ESX1L
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
865,00 €
Bewerten
ESX1 PrEST Antigen
ESX1 PrEST Antigen

Artikelnummer: ATA-APrEST83912.100

Protein function: May coordinately regulate cell cycle progression and transcription during spermatogenesis. Inhibits degradation of polyubiquitinated cyclin A and cyclin B1 and thereby arrests the cell cycle at early M phase. ESXR1-N acts as a transcriptional repressor. Binds to the sequence 5'-TAATGTTATTA-3' which...
Schlagworte: ESX1, ESX1L
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
Anti-ESX1
Anti-ESX1

Artikelnummer: ELK-ES16662.100

This gene encodes a dual-function 65 kDa protein that undergoes proteolytic cleavage to produce a 45 kDa N-terminal fragment with a paired-like homeodomain and a 20 kDa C-terminal fragment with a proline-rich domain. The C-terminal fragment localizes to the cytoplasm while the N-terminal fragment localizes...
Schlagworte: Anti-ESX1, Anti-ESX1L, ESX1 rabbit pAb
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, rat, mouse,
ab 173,00 €
Bewerten
Anti-ESX1
Anti-ESX1

Artikelnummer: CSB-PA007838GA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: ESX1. Antigen Species: Human
Schlagworte: Anti-ESX1, Anti-ESX1L, ESX1 antibody, ESX1L antibody, ESX1R antibody, Homeobox protein ESX1 antibody, Extraembryonic...
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
552,00 €
Bewerten
ESX1 (human), recombinant protein
ESX1 (human), recombinant protein

Artikelnummer: ABS-PP-10621.100

Protein function: May coordinately regulate cell cycle progression and transcription during spermatogenesis. Inhibits degradation of polyubiquitinated cyclin A and cyclin B1 and thereby arrests the cell cycle at early M phase. ESXR1-N acts as a transcriptional repressor. Binds to the sequence 5'-TAATGTTATTA-3' which...
Schlagworte: Homeobox protein ESX1, Extraembryonic, spermatogenesis, homeobox 1) [Cleaved into: Homeobox protein ESX1-N, Homeobox...
Exprimiert in: E.coli
Ursprungsart: human
MW: 15 kD
ab 90,00 €
Bewerten
ESX1 PrEST Antigen
ESX1 PrEST Antigen

Artikelnummer: ATA-APrEST96154.100

PrEST Antigen ESX1, Gene description: ESX homeobox 1, Alternative Gene Names: ESX1L, ESXR1, Antigen sequence: MESLRGYTHSDIGYRSLAVGEDIEEVNDEKLTVTSLMARGGEDEENTRSKPEYGTEAENNVGTEGSVPSDDQDR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May coordinately regulate cell cycle...
Schlagworte: ESX1, ESX1L
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten