Zu "GeneID 79772" wurden 5 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-MCTP1
Artikelnummer: ATA-HPA075887.100
Polyclonal Antibody against Human MCTP1, Gene description: multiple C2 and transmembrane domain containing 1, Alternative Gene Names: FLJ22344, Validated applications: ICC, WB, Uniprot ID: Q6DN14, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Calcium...
| Schlagworte: | Anti-MCTP1, Anti-Multiple C2 and transmembrane domain-containing protein 1 |
| Anwendung: | WB, ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
MCTP1 (human), recombinant protein
Artikelnummer: ABS-PP-2302-L.100
Protein function: Calcium sensor which is essential for the stabilization of normal baseline neurotransmitter release and for the induction and long-term maintenance of presynaptic homeostatic plasticity. [The UniProt Consortium]
| Schlagworte: | Multiple C2 and transmembrane domain-containing protein 1, Recombinant Human MCTP1 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 15.5 kD |
ab 115,00 €
MCTP1, Human multiple C2 domains, transmembrane 1, Real...
Artikelnummer: VHPS-5622
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | MCTP1, Multiple C2 and transmembrane domain-containing protein 1 |
| Anwendung: | RNA quantification |
45,00 €
MCTP1 (human), recombinant protein
Artikelnummer: ABS-PP-2302.100
Protein function: Calcium sensor which is essential for the stabilization of normal baseline neurotransmitter release and for the induction and long-term maintenance of presynaptic homeostatic plasticity. [The UniProt Consortium]
| Schlagworte: | Multiple C2 and transmembrane domain-containing protein 1, Recombinant Human MCTP1 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 15.5 kD |
ab 90,00 €
MCTP1 PrEST Antigen
Artikelnummer: ATA-APrEST96232.100
PrEST Antigen MCTP1, Gene description: multiple C2 and transmembrane domain containing 1, Alternative Gene Names: FLJ22344, Antigen sequence: MLDSCKLKSACNLPFICNKKIINTAGTSNAEVPLADPGMYQLDITLRRGQSLAARDRGGTSD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Calcium sensor...
| Schlagworte: | MCTP1, Multiple C2 and transmembrane domain-containing protein 1 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
