- Suchergebnis für GeneID 79713
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 79713" wurden 11 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: TGM-TMPH-01515-10ug
Description: Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.
| Schlagworte: | IGFLR1 , TMEM149 , U2AF1L4 , Transmembrane protein 149 , IGF-like family receptor 1 , U2 small nuclear RNA auxiliary... |
| MW: | 17.4 kD |
ab 48,00 €
Artikelnummer: CSB-MP862025HU.1
Organism: Homo sapiens (Human). Source: Mammalian cell. Expression Region: 23-163aa. Protein Length: Partial. Tag Info: C-terminal 6xHis-tagged. Target Protein Sequence: SQYCGRLEYW NPDNKCCSSC LQRFGPPPCP DYEFRENCGL NDHGDFVTPP FRKCSSGQCN PDGAELCSPC GGGAVTPTPA AGGGRTPWRC RERPVPAKGH CPLTPGNPGA PSSQERSSPA SSIAWRTPEP...
| Schlagworte: | IGFLR1, TMEM149, Transmembrane protein 149, IGF-like family receptor 1, U2 small nuclear RNA auxiliary factor 1-like 4,... |
| Anwendung: | Active protein |
| Exprimiert in: | Mammalian cells |
| Ursprungsart: | human |
| MW: | 17.4 kD |
ab 142,00 €
Artikelnummer: CSB-MP862025HUd9.1
Organism: Homo sapiens (Human). Source: Mammalian cell. Expression Region: 23-163aa. Protein Length: Partial. Tag Info: C-terminal hFc-tagged. Target Protein Sequence: SQYCGRLEYW NPDNKCCSSC LQRFGPPPCP DYEFRENCGL NDHGDFVTPP FRKCSSGQCN PDGAELCSPC GGGAVTPTPA AGGGRTPWRC RERPVPAKGH CPLTPGNPGA PSSQERSSPA SSIAWRTPEP...
| Schlagworte: | IGFLR1, TMEM149, Transmembrane protein 149, IGF-like family receptor 1, U2 small nuclear RNA auxiliary factor 1-like 4,... |
| Anwendung: | Active protein |
| Exprimiert in: | Mammalian cells |
| Ursprungsart: | human |
| MW: | 44.1 kD |
ab 142,00 €
Artikelnummer: TGM-TMPH-01515-100ug
Description: Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.
| Schlagworte: | IGFLR1, U2 small nuclear RNA auxiliary factor 1-like 4, Transmembrane protein 149, IGF-like family receptor 1 |
| MW: | 17.4 kD |
ab 120,00 €
Artikelnummer: TGM-TMPY-04160-100ug
Description: IGFLR1 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 41.4 kDa and the accession number is Q9H665-1.
| Schlagworte: | IGFLR1, IGF-like family receptor 1, U2AF1L4, TMEM149 |
| MW: | 41.4 kD |
768,00 €
Artikelnummer: ATA-HPA070778.100
Polyclonal Antibody against Human IGFLR1, Gene description: IGF like family receptor 1, Alternative Gene Names: FLJ22573, TMEM149, U2AF1L4, Validated applications: ICC, Uniprot ID: Q9H665, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Probable cell...
| Schlagworte: | Anti-IGFLR1, Anti-TMEM149, Anti-Transmembrane protein 149, Anti-IGF-like family receptor 1, Anti-U2 small nuclear RNA... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
NEU
Artikelnummer: ATA-HPA070778.25
Polyclonal Antibody against Human IGFLR1, Gene description: IGF like family receptor 1, Alternative Gene Names: FLJ22573, TMEM149, U2AF1L4, Validated applications: ICC, Uniprot ID: Q9H665, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Probable cell...
| Schlagworte: | Anti-IGFLR1, Anti-TMEM149, Anti-Transmembrane protein 149, Anti-IGF-like family receptor 1, Anti-U2 small nuclear RNA... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
241,00 €
Artikelnummer: TGM-TMPY-04160-10ug
Description: IGFLR1 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 41.4 kDa and the accession number is Q9H665-1.
| Schlagworte: | IGFLR1 , IGF-like family receptor 1 , U2AF1L4 , TMEM149 |
| MW: | 41.4 kD |
ab 75,00 €
Artikelnummer: VHPS-9355
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | IGFLR1, TMEM149, Transmembrane protein 149, IGF-like family receptor 1, U2 small nuclear RNA auxiliary factor 1-like 4 |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: ELK-ES15510.100
Protein function: Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2. [The UniProt Consortium] Recommended dilutions: WB 1:500-2000. Cellular localization: Cell membrane , Single-pass type I membrane protein .
| Schlagworte: | Anti-IGFLR1, Anti-TMEM149, Anti-Transmembrane protein 149, Anti-IGF-like family receptor 1, Anti-U2 small nuclear RNA... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
Artikelnummer: ATA-APrEST96115.100
PrEST Antigen IGFLR1, Gene description: IGF like family receptor 1, Alternative Gene Names: FLJ22573, TMEM149, U2AF1L4, Antigen sequence: LEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Probable cell membrane...
| Schlagworte: | IGFLR1, TMEM149, Transmembrane protein 149, IGF-like family receptor 1, U2 small nuclear RNA auxiliary factor 1-like 4 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €