Zu "GeneID 728591" wurden 6 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-CCDC169
Anti-CCDC169

Artikelnummer: ATA-HPA040527.100

Polyclonal Antibody against Human CCDC169, Gene description: coiled-coil domain containing 169, Alternative Gene Names: C13orf38, LOC728591, RP11-251J8.1, Validated applications: ICC, Uniprot ID: A6NNP5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity:...
Schlagworte: Anti-CCDC169, Anti-C13orf38, Anti-Coiled-coil domain-containing protein 169
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
Anti-CCDC169
Anti-CCDC169

Artikelnummer: ATA-HPA040527.25

Polyclonal Antibody against Human CCDC169, Gene description: coiled-coil domain containing 169, Alternative Gene Names: C13orf38, LOC728591, RP11-251J8.1, Validated applications: ICC, Uniprot ID: A6NNP5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity:...
Schlagworte: Anti-CCDC169, Anti-C13orf38, Anti-Coiled-coil domain-containing protein 169
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
361,00 €
Bewerten
C13orf38, Human chromosome 13 open reading frame 38, Real Time PCR Primer Set
C13orf38, Human chromosome 13 open reading frame 38, Real...

Artikelnummer: VHPS-1008

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: C13orf38, UPF0594 protein C13orf38
Anwendung: RNA quantification
45,00 €
Bewerten
CCDC169 (human), recombinant protein
CCDC169 (human), recombinant protein

Artikelnummer: ABS-PP-9656.100

Schlagworte: Coiled-coil domain-containing protein 169, Recombinant Human CCDC169 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 26 kD
ab 90,00 €
Bewerten
CCDC169 PrEST Antigen
CCDC169 PrEST Antigen

Artikelnummer: ATA-APrEST95859.100

PrEST Antigen CCDC169, Gene description: coiled-coil domain containing 169, Alternative Gene Names: C13orf38, LOC728591, RP11-251J8.1, Antigen sequence: VKTLLLKEELDPLKVSCLETLGFSAAGVAGPENRTCLGQKALWPACLHGSSTLAVCQTHL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 33% Rat...
Schlagworte: CCDC169, C13orf38, Coiled-coil domain-containing protein 169
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
CCDC169 (human), recombinant protein
CCDC169 (human), recombinant protein

Artikelnummer: ABS-PP-9656-L.100

Schlagworte: Coiled-coil domain-containing protein 169, Recombinant Human CCDC169 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 26 kD
ab 115,00 €
Bewerten