Zu "GeneID 728116" wurden 8 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ZBTB8B
Artikelnummer: ATA-HPA055553.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 84% and to rat: 88%
| Schlagworte: | Anti-ZBTB8B, Anti-Zinc finger and BTB domain-containing protein 8B |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Anti-ZBTB8B
Artikelnummer: ATA-HPA071427.100
Polyclonal Antibody against Human ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Validated applications: ICC, Uniprot ID: Q8NAP8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Schlagworte: | Anti-ZBTB8B, Anti-Zinc finger and BTB domain-containing protein 8B |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
NEU
Anti-ZBTB8B
Artikelnummer: ATA-HPA071427.25
Polyclonal Antibody against Human ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Validated applications: ICC, Uniprot ID: Q8NAP8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Schlagworte: | Anti-ZBTB8B, Anti-Zinc finger and BTB domain-containing protein 8B |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
ZBTB8B (human), recombinant protein
Artikelnummer: ABS-PP-3613-L.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
| Schlagworte: | Zinc finger and BTB domain-containing protein 8B, Recombinant Human ZBTB8B Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 11.5 kD |
ab 115,00 €
Anti-ZBTB8B, CT (ZBTB8B, Zinc finger and BTB...
Artikelnummer: 044011.200
ZBTB8B may be involved in transcriptional regulation. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are...
| Schlagworte: | Anti-ZBTB8B, Anti-Zinc finger and BTB domain-containing protein 8B |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
ZBTB8B PrEST Antigen
Artikelnummer: ATA-APrEST89159.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | ZBTB8B, Zinc finger and BTB domain-containing protein 8B |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
ZBTB8B (human), recombinant protein
Artikelnummer: ABS-PP-3613.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
| Schlagworte: | Zinc finger and BTB domain-containing protein 8B, Recombinant Human ZBTB8B Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 11.5 kD |
ab 90,00 €
ZBTB8B PrEST Antigen
Artikelnummer: ATA-APrEST95606.100
PrEST Antigen ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Antigen sequence: AVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFSRSLEGRPEGAGVAMSSMMDVQADWYGEDSGDVLVVP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Schlagworte: | ZBTB8B, Zinc finger and BTB domain-containing protein 8B |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €