- Suchergebnis für GeneID 728116
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 728116" wurden 8 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA055553.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 84% and to rat: 88%
| Schlagworte: | Anti-ZBTB8B, Anti-Zinc finger and BTB domain-containing protein 8B |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Artikelnummer: ATA-HPA071427.100
Polyclonal Antibody against Human ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Validated applications: ICC, Uniprot ID: Q8NAP8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Schlagworte: | Anti-ZBTB8B, Anti-Zinc finger and BTB domain-containing protein 8B |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
NEU
Artikelnummer: ATA-HPA071427.25
Polyclonal Antibody against Human ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Validated applications: ICC, Uniprot ID: Q8NAP8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Schlagworte: | Anti-ZBTB8B, Anti-Zinc finger and BTB domain-containing protein 8B |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: ABS-PP-3613-L.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
| Schlagworte: | Zinc finger and BTB domain-containing protein 8B, Recombinant Human ZBTB8B Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 11.5 kD |
ab 115,00 €
Artikelnummer: 044011.200
ZBTB8B may be involved in transcriptional regulation. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are...
| Schlagworte: | Anti-ZBTB8B, Anti-Zinc finger and BTB domain-containing protein 8B |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Artikelnummer: ATA-APrEST89159.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | ZBTB8B, Zinc finger and BTB domain-containing protein 8B |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ABS-PP-3613.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
| Schlagworte: | Zinc finger and BTB domain-containing protein 8B, Recombinant Human ZBTB8B Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 11.5 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95606.100
PrEST Antigen ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Antigen sequence: AVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFSRSLEGRPEGAGVAMSSMMDVQADWYGEDSGDVLVVP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Schlagworte: | ZBTB8B, Zinc finger and BTB domain-containing protein 8B |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €