Zu "GeneID 72373" wurden 14 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Prostate stem cell antigen (Psca), mouse, recombinant
Artikelnummer: CSB-YP018840MO.1
Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 21-95aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: LQCYSCTAQM NNRDCLNVQN CSLDQHSCFT SRIRAIGLVT VISKGCSSQC EDDSENYYLG KKNITCCYSD LCNVN. Purity: Greater than 90% as determined by SDS-PAGE....
| Schlagworte: | Psca, Prostate stem cell antigen, Recombinant Mouse Prostate stem cell antigen (Psca) |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | mouse |
| MW: | 10.4 kD |
ab 292,00 €
Mouse PSCA Protein, hFc Tag
Artikelnummer: DIM-PME-M100045.10
Recombinant mouse PSCA protein with C-terminal human Fc tag. Mouse PSCA(Leu21-Asn95) hFc(Glu99-Ala330), Protein function: May be involved in the regulation of cell proliferation. [The UniProt Consortium]
| Schlagworte: | UNQ206, PRO232 |
| Exprimiert in: | Human cells |
| Ursprungsart: | mouse |
| MW: | 34.5 kD |
ab 151,00 €
PSCA Protein, Mouse, Recombinant (hFc)
Artikelnummer: TGM-TMPK-00906-100ug
Description: Gastric cancer is a deadly malignancy and is a prognostically unfavorable entity with restricted therapeutic strategies available. Prostate stem cell antigen (PSCA) is a glycosylphosphatidylinositol (GPI)-anchored cell surface protein widely expressed in bladder, prostate, and pancreatic cancers....
| Schlagworte: | PSCA, UNQ206, PRO232 |
| MW: | 34.5 kD |
ab 460,00 €
PSCA Protein, Mouse, Recombinant (His & Avi), Biotinylated
Artikelnummer: TGM-TMPY-06655-100ug
Description: PSCA Protein, Mouse, Recombinant (His & Avi), Biotinylated is expressed in HEK293 mammalian cells with His and Avi tag. The predicted molecular weight is 11.64 kDa and the accession number is P57096.
| Schlagworte: | 2210408B04Rik, prostate stem cell antigen |
| MW: | 11.64 kD |
ab 568,00 €
PSCA Protein, Mouse, Recombinant (His)
Artikelnummer: TGM-TMPY-06710-100ug
Description: PSCA Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 9.83 kDa and the accession number is P57096.
| Schlagworte: | prostate stem cell antigen, 2210408B04Rik |
| MW: | 9.83 kD |
ab 658,00 €
PSCA Protein, Mouse, Recombinant (His & Avi), Biotinylated
Artikelnummer: TGM-TMPY-06655-10ug
Description: PSCA Protein, Mouse, Recombinant (His & Avi), Biotinylated is expressed in HEK293 mammalian cells with His and Avi tag. The predicted molecular weight is 11.64 kDa and the accession number is P57096.
| Schlagworte: | prostate stem cell antigen , 2210408B04Rik |
| MW: | 11.64 kD |
ab 202,00 €
PSCA Protein, Mouse, Recombinant (His)
Artikelnummer: TGM-TMPY-06710-10ug
Description: PSCA Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 9.8 kDa and the accession number is P57096.
| Schlagworte: | prostate stem cell antigen , 2210408B04Rik |
| MW: | 9.8 kD |
ab 65,00 €
PSAP/Prosaposin, His, Mouse
Artikelnummer: GSC-Z06323-100
Prosaposin (also known as SGP-1) is an intriguing multifunctional protein that plays roles both intracellularly, as a regulator of lysosomal enzyme function, and extracellularly, as a secreted factor with neuroprotective and glioprotective effects.
| Schlagworte: | Psca, Prostate stem cell antigen |
| Ursprungsart: | mouse |
| MW: | 60.86 kD |
ab 524,00 €
PSCA hFc Chimera, Mouse
Artikelnummer: GSC-Z06325-100
Gastric cancer is a deadly malignancy and is a prognostically unfavorable entity with restricted therapeutic strategies available. Prostate stem cell antigen (PSCA) is a glycosylphosphatidylinositol (GPI)-anchored cell surface protein widely expressed in bladder, prostate, and pancreatic cancers. Existing studies...
| Schlagworte: | Psca, Prostate stem cell antigen |
| Ursprungsart: | mouse |
| MW: | 34.5 kD |
ab 524,00 €
PSCA Protein, Mouse, Recombinant (hFc)
Artikelnummer: TGM-TMPK-00906-10ug
Description: Gastric cancer is a deadly malignancy and is a prognostically unfavorable entity with restricted therapeutic strategies available. Prostate stem cell antigen (PSCA) is a glycosylphosphatidylinositol (GPI)-anchored cell surface protein widely expressed in bladder, prostate, and pancreatic cancers....
| Schlagworte: | UNQ206 , PSCA , PRO232 |
| MW: | 34.5 kD |
ab 55,00 €
Psca, Mouse prostate stem cell antigen, Real Time PCR...
Artikelnummer: VMPS-5109
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Psca, mCG_2793, Prostate stem cell antigen |
| Anwendung: | RNA quantification |
45,00 €
PSCA, Recombinant, Mouse, aa21-95, His-Tag (Prostate Stem...
Artikelnummer: 374902.100
May be involved in the regulation of cell proliferation. Source: Recombinant protein corresponding to aa21-95 from mouse PSCA, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~10.4kD, AA Sequence: LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN, Storage and...
| Schlagworte: | Psca, Prostate stem cell antigen |
| MW: | 10,4 |
ab 636,00 €