- Suchergebnis für GeneID 72373
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 72373" wurden 14 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: CSB-YP018840MO.1
Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 21-95aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: LQCYSCTAQM NNRDCLNVQN CSLDQHSCFT SRIRAIGLVT VISKGCSSQC EDDSENYYLG KKNITCCYSD LCNVN. Purity: Greater than 90% as determined by SDS-PAGE....
| Schlagworte: | Psca, Prostate stem cell antigen, Recombinant Mouse Prostate stem cell antigen (Psca) |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | mouse |
| MW: | 10.4 kD |
ab 292,00 €
Artikelnummer: DIM-PME-M100045.10
Recombinant mouse PSCA protein with C-terminal human Fc tag. Mouse PSCA(Leu21-Asn95) hFc(Glu99-Ala330), Protein function: May be involved in the regulation of cell proliferation. [The UniProt Consortium]
| Schlagworte: | UNQ206, PRO232 |
| Exprimiert in: | Human cells |
| Ursprungsart: | mouse |
| MW: | 34.5 kD |
ab 151,00 €
Artikelnummer: TGM-TMPK-00906-100ug
Description: Gastric cancer is a deadly malignancy and is a prognostically unfavorable entity with restricted therapeutic strategies available. Prostate stem cell antigen (PSCA) is a glycosylphosphatidylinositol (GPI)-anchored cell surface protein widely expressed in bladder, prostate, and pancreatic cancers....
| Schlagworte: | PSCA, UNQ206, PRO232 |
| MW: | 34.5 kD |
ab 460,00 €
Artikelnummer: TGM-TMPY-06655-100ug
Description: PSCA Protein, Mouse, Recombinant (His & Avi), Biotinylated is expressed in HEK293 mammalian cells with His and Avi tag. The predicted molecular weight is 11.64 kDa and the accession number is P57096.
| Schlagworte: | 2210408B04Rik, prostate stem cell antigen |
| MW: | 11.64 kD |
ab 568,00 €
Artikelnummer: TGM-TMPY-06710-100ug
Description: PSCA Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 9.83 kDa and the accession number is P57096.
| Schlagworte: | prostate stem cell antigen, 2210408B04Rik |
| MW: | 9.83 kD |
ab 658,00 €
Artikelnummer: GSC-Z06323-100
Prosaposin (also known as SGP-1) is an intriguing multifunctional protein that plays roles both intracellularly, as a regulator of lysosomal enzyme function, and extracellularly, as a secreted factor with neuroprotective and glioprotective effects.
| Schlagworte: | Psca, Prostate stem cell antigen |
| Ursprungsart: | mouse |
| MW: | 60.86 kD |
ab 524,00 €
Artikelnummer: GSC-Z06325-100
Gastric cancer is a deadly malignancy and is a prognostically unfavorable entity with restricted therapeutic strategies available. Prostate stem cell antigen (PSCA) is a glycosylphosphatidylinositol (GPI)-anchored cell surface protein widely expressed in bladder, prostate, and pancreatic cancers. Existing studies...
| Schlagworte: | Psca, Prostate stem cell antigen |
| Ursprungsart: | mouse |
| MW: | 34.5 kD |
ab 524,00 €
Artikelnummer: TGM-TMPK-00906-10ug
Description: Gastric cancer is a deadly malignancy and is a prognostically unfavorable entity with restricted therapeutic strategies available. Prostate stem cell antigen (PSCA) is a glycosylphosphatidylinositol (GPI)-anchored cell surface protein widely expressed in bladder, prostate, and pancreatic cancers....
| Schlagworte: | UNQ206 , PSCA , PRO232 |
| MW: | 34.5 kD |
ab 55,00 €
Artikelnummer: TGM-TMPY-06655-10ug
Description: PSCA Protein, Mouse, Recombinant (His & Avi), Biotinylated is expressed in HEK293 mammalian cells with His and Avi tag. The predicted molecular weight is 11.64 kDa and the accession number is P57096.
| Schlagworte: | prostate stem cell antigen , 2210408B04Rik |
| MW: | 11.64 kD |
ab 202,00 €
Artikelnummer: TGM-TMPY-06710-10ug
Description: PSCA Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 9.8 kDa and the accession number is P57096.
| Schlagworte: | prostate stem cell antigen , 2210408B04Rik |
| MW: | 9.8 kD |
ab 65,00 €
Artikelnummer: VMPS-5109
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Psca, mCG_2793, Prostate stem cell antigen |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: 374902.100
May be involved in the regulation of cell proliferation. Source: Recombinant protein corresponding to aa21-95 from mouse PSCA, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~10.4kD, AA Sequence: LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN, Storage and...
| Schlagworte: | Psca, Prostate stem cell antigen |
| MW: | 10,4 |
ab 636,00 €