- Suchergebnis für GeneID 64921
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 64921" wurden 11 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA044404.100
Protein function: O-acetyltransferase that catalyzes 9-O-acetylation of sialic acids (PubMed:20947662, PubMed:26169044). Sialic acids are sugars at the reducing end of glycoproteins and glycolipids, and are involved in various processes such as cell-cell interactions, host-pathogen recognition (PubMed:20947662,...
| Schlagworte: | Anti-SOAT, Anti-C7orf12, Anti-Nbla04196, Anti-Sialate O-acetyltransferase, Anti-CAS1 domain-containing protein 1,... |
| Anwendung: | ICC, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Artikelnummer: CSB-EP846683HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 39-313aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: ASRRYRGNDS CEYLLSSGRF LGEKVWQPHS CMMHKYKISE AKNCLVDKHI AFIGDSRIRQ LFYSFVKIIN PQFKEEGNKH ENIPFEDKTA SVKVDFLWHP EVNGSMKQCI KVWTEDSIAK PHVIVAGAAT...
| Schlagworte: | SOAT, C7orf12, Nbla04196, Sialate O-acetyltransferase, CAS1 domain-containing protein 1, N-acetylneuraminate... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 47.2 kD |
ab 219,00 €
Artikelnummer: ATA-HPA052908.100
Polyclonal Antibody against Human CASD1, Gene description: CAS1 domain containing 1, Alternative Gene Names: C7orf12, FLJ21213, FLJ21879, Validated applications: IHC, Uniprot ID: Q96PB1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: O-acetyltransferase...
| Schlagworte: | Anti-SOAT, Anti-C7orf12, Anti-Nbla04196, Anti-Sialate O-acetyltransferase, Anti-CAS1 domain-containing protein 1,... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ABS-PP-3125-L.100
Protein function: O-acetyltransferase that catalyzes 9-O-acetylation of sialic acids (PubMed:20947662, PubMed:26169044). Sialic acids are sugars at the reducing end of glycoproteins and glycolipids, and are involved in various processes such as cell-cell interactions, host-pathogen recognition (PubMed:20947662,...
| Schlagworte: | N-acetylneuraminate 9-O-acetyltransferase, CAS1 domain-containing protein 1, Sialate O-acetyltransferase, SOAT,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 17.5 kD |
ab 115,00 €
Artikelnummer: C2084-10-APC.200
Applications: , Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: FLISA: 1:1,000, Western Blot: 1:100-1:500, Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and...
| Schlagworte: | Anti-CASD1, Anti-C7orf12, Anti-Nbla04196, Anti-CAS1 domain-containing protein 1 |
| Anwendung: | FLISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
1.104,00 €
Artikelnummer: C2084-10.200
Applications: , Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-1:500, Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and...
| Schlagworte: | Anti-CAS1 domain-containing protein 1 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
865,00 €
Artikelnummer: 372576.1
Source:, Recombinant protein corresponding to aa39-313 from human CASD1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.2kD, AA Sequence:...
| Schlagworte: | SOAT, C7orf12, Nbla04196, Sialate O-acetyltransferase, CAS1 domain-containing protein 1, N-acetylneuraminate... |
| MW: | 47,2 |
ab 603,00 €
Artikelnummer: ATA-APrEST74963.100
Protein function: O-acetyltransferase that catalyzes 9-O-acetylation of sialic acids (PubMed:20947662, PubMed:26169044). Sialic acids are sugars at the reducing end of glycoproteins and glycolipids, and are involved in various processes such as cell-cell interactions, host-pathogen recognition (PubMed:20947662,...
| Schlagworte: | SOAT, C7orf12, Nbla04196, Sialate O-acetyltransferase, CAS1 domain-containing protein 1, N-acetylneuraminate... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ABS-PP-3125.100
Protein function: O-acetyltransferase that catalyzes 9-O-acetylation of sialic acids (PubMed:20947662, PubMed:26169044). Sialic acids are sugars at the reducing end of glycoproteins and glycolipids, and are involved in various processes such as cell-cell interactions, host-pathogen recognition (PubMed:20947662,...
| Schlagworte: | N-acetylneuraminate 9-O-acetyltransferase, CAS1 domain-containing protein 1, Sialate O-acetyltransferase, SOAT,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 17.5 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95904.100
PrEST Antigen CASD1, Gene description: CAS1 domain containing 1, Alternative Gene Names: C7orf12, FLJ21213, FLJ21879, Antigen sequence: LNSSTRNSKSNVKMFSVSKLIAQETIMESLDGLHLPESSRETTAMILMNVYCNKILKPVDGSCCQPRPPVTL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Schlagworte: | SOAT, C7orf12, Nbla04196, Sialate O-acetyltransferase, CAS1 domain-containing protein 1, N-acetylneuraminate... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: CSB-PA846683ZA01HU.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-SOAT, Anti-C7orf12, Anti-Nbla04196, Anti-Sialate O-acetyltransferase, Anti-CAS1 domain-containing protein 1,... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Homo sapiens (Human) |
ab 1.529,00 €