Zu "GeneID 646799" wurden 7 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ZAR1L
Anti-ZAR1L

Artikelnummer: ATA-HPA041319.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 35% and to rat: 30%
Schlagworte: Anti-ZAR1L, Anti-ZAR1-like protein
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 246,00 €
Bewerten
Anti-ZAR1L
Anti-ZAR1L

Artikelnummer: ATA-HPA039540.100

Polyclonal Antibody against Human ZAR1L, Gene description: zygote arrest 1 like, Alternative Gene Names: Z3CXXC7, Validated applications: ICC, Uniprot ID: A6NP61, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 44% Rat gene identity: 44%
Schlagworte: Anti-ZAR1L, Anti-ZAR1-like protein
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
NEU
Anti-ZAR1L
Anti-ZAR1L

Artikelnummer: ATA-HPA039540.25

Polyclonal Antibody against Human ZAR1L, Gene description: zygote arrest 1 like, Alternative Gene Names: Z3CXXC7, Validated applications: ICC, Uniprot ID: A6NP61, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 44% Rat gene identity: 44%
Schlagworte: Anti-ZAR1L, Anti-ZAR1-like protein
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
361,00 €
Bewerten
ZAR1L (human), recombinant protein
ZAR1L (human), recombinant protein

Artikelnummer: ABS-PP-9500-L.100

Schlagworte: Protein ZAR1-like, Zygote arrest protein 1-like, Recombinant Human ZAR1L Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 16 kD
ab 115,00 €
Bewerten
ZAR1L PrEST Antigen
ZAR1L PrEST Antigen

Artikelnummer: ATA-APrEST81392.100

Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: ZAR1L, ZAR1-like protein
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
ZAR1L (human), recombinant protein
ZAR1L (human), recombinant protein

Artikelnummer: ABS-PP-9500.100

Schlagworte: Protein ZAR1-like, Zygote arrest protein 1-like, Recombinant Human ZAR1L Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 16 kD
ab 90,00 €
Bewerten
ZAR1L PrEST Antigen
ZAR1L PrEST Antigen

Artikelnummer: ATA-APrEST95928.100

PrEST Antigen ZAR1L, Gene description: zygote arrest 1 like, Alternative Gene Names: Z3CXXC7, Antigen sequence: FVRVPYGLYQGYGSTVPLGQPGLSGHKQPDWRQNMGPPTFLARPGLLVPANAPDYCIDPYKRAQLKAILSQMNPSLSPRLCKPNTK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 44% Rat gene identity:...
Schlagworte: ZAR1L, ZAR1-like protein
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten