Zu "GeneID 6307" wurden 11 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-MSMO1
Artikelnummer: E-AB-16412.120
Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. The protein is localized to the endoplasmic reticulum membrane and is believed to...
| Schlagworte: | Anti-DESP4, Anti-MSMO1, Anti-C-4 methylsterol oxidase, Anti-Methylsterol monooxygenase 1, MSMO1 Polyclonal Antibody |
| Anwendung: | IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 89,00 €
Anti-MSMO1
Artikelnummer: ATA-HPA056127.100
Protein function: Catalyzes the three-step monooxygenation required for the demethylation of 4,4-dimethyl and 4alpha-methylsterols, which can be subsequently metabolized to cholesterol (PubMed:21285510, PubMed:28673550, PubMed:23583456, PubMed:26114596). Also involved in drug metabolism, as it can metabolize...
| Schlagworte: | Anti-DESP4, Anti-MSMO1, Anti-C-4 methylsterol oxidase, Anti-Sterol-C4-methyl oxidase, Anti-Methylsterol monooxygenase 1 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Anti-MSMO1
Artikelnummer: CSB-PA955910.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: MSMO1. Antigen Species: Human
| Schlagworte: | Anti-MSMO1, Anti-DESP4, Anti-Sterol-C4-methyl oxidase, Anti-C-4 methylsterol oxidase, Anti-Methylsterol monooxygenase 1,... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-MSMO1
Artikelnummer: CSB-PA972591.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: MSMO1. Antigen Species: Human
| Schlagworte: | Anti-MSMO1, Anti-DESP4, Anti-Sterol-C4-methyl oxidase, Anti-C-4 methylsterol oxidase, Anti-Methylsterol monooxygenase 1,... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-MSMO1
Artikelnummer: ATA-HPA055073.100
Polyclonal Antibody against Human MSMO1, Gene description: methylsterol monooxygenase 1, Alternative Gene Names: DESP4, ERG25, SC4MOL, Validated applications: ICC, Uniprot ID: Q15800, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Catalyzes the three-step...
| Schlagworte: | Anti-DESP4, Anti-MSMO1, Anti-C-4 methylsterol oxidase, Anti-Sterol-C4-methyl oxidase, Anti-Methylsterol monooxygenase 1 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Anti-MSMO1
Artikelnummer: ATA-HPA055073.25
Polyclonal Antibody against Human MSMO1, Gene description: methylsterol monooxygenase 1, Alternative Gene Names: DESP4, ERG25, SC4MOL, Validated applications: ICC, Uniprot ID: Q15800, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Catalyzes the three-step...
| Schlagworte: | Anti-DESP4, Anti-MSMO1, Anti-C-4 methylsterol oxidase, Anti-Sterol-C4-methyl oxidase, Anti-Methylsterol monooxygenase 1 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
SC4MOL, Human sterol-C4-methyl oxidase-like, Real Time...
Artikelnummer: VHPS-8119
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | DESP4, SC4MOL, EC=1.14.13.72, C-4 methylsterol oxidase, Methylsterol monooxygenase |
| Anwendung: | RNA quantification |
45,00 €
Anti-ERG25, CT (MSMO1, DESP4, ERG25, SC4MOL, Methylsterol...
Artikelnummer: 035202.200
Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. The protein is localized to the endoplasmic reticulum membrane and is believed to...
| Schlagworte: | Anti-MSMO1, Anti-DESP4, EC=1.14.13.72, Anti-C-4 methylsterol oxidase, Anti-Methylsterol monooxygenase 1 |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
MSMO1 PrEST Antigen
Artikelnummer: ATA-APrEST85272.100
Protein function: Catalyzes the three-step monooxygenation required for the demethylation of 4,4-dimethyl and 4alpha-methylsterols, which can be subsequently metabolized to cholesterol (PubMed:21285510, PubMed:28673550, PubMed:23583456, PubMed:26114596). Also involved in drug metabolism, as it can metabolize...
| Schlagworte: | DESP4, MSMO1, C-4 methylsterol oxidase, Sterol-C4-methyl oxidase, Methylsterol monooxygenase 1 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-MSMO1
Artikelnummer: ELK-ES14699.100
Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. The protein is localized to the endoplasmic reticulum membrane and is believed to...
| Schlagworte: | Anti-MSMO1, Anti-DESP4, Anti-C-4 methylsterol oxidase, Anti-Sterol-C4-methyl oxidase, Anti-Methylsterol monooxygenase 1,... |
| Anwendung: | WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 173,00 €
MSMO1 PrEST Antigen
Artikelnummer: ATA-APrEST95657.100
PrEST Antigen MSMO1, Gene description: methylsterol monooxygenase 1, Alternative Gene Names: DESP4, ERG25, SC4MOL, Antigen sequence: VHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYNA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Catalyzes the three-step...
| Schlagworte: | MSMO1, DESP4, C-4 methylsterol oxidase, Sterol-C4-methyl oxidase, Methylsterol monooxygenase 1 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €