- Suchergebnis für GeneID 6166
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 6166" wurden 16 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ARG40081.100
| Schlagworte: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
707,00 €
Artikelnummer: CSB-RP018044h.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-106aa. Protein Length: Full Length. Tag Info: N-terminal GST-tagged. Target Protein Sequence: MVNVPKTRRT FCKKCGKHQP HKVTQYKKGK DSLYAQGRRR YDRKQSGYGG QTKPIFRKKA KTTKKIVLRL ECVEPNCRSK RMLAIKRCKH FELGGDKKRK GQVIQF. Purity: Greater than 90% as...
| Schlagworte: | RPL36AL, 60S ribosomal protein L36a-like, Large ribosomal subunit protein eL42-like, Recombinant Human 60S ribosomal... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 39.5 kD |
ab 219,00 €
Artikelnummer: CSB-PA01804A0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Schlagworte: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA01805A0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Schlagworte: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: ABS-PP-10782-L.100
| Schlagworte: | Ribosomal protein eL42-like, 60S ribosomal protein L36a-like, Large ribosomal subunit protein eL42-like, Recombinant Human... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 13 kD |
ab 115,00 €
Artikelnummer: 375106.1
Belongs to the ribosomal protein L44e family. Source: Recombinant protein corresponding to aa1-106 from RPL36AL, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.5kD, AA Sequence: MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF,...
| Schlagworte: | RPL36AL, 60S ribosomal protein L36a-like, Large ribosomal subunit protein eL42-like |
| MW: | 39,5 |
ab 603,00 €
Artikelnummer: G-CAB14366.20
RPL36AL Rabbit Polyclonal Antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in WB IF applications.RPL36AL Rabbit Polyclonal Antibody is an IgG isotype antibody and produced in Rabbit and purified by Affinity purification from Assay Genie.
| Schlagworte: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like |
| Anwendung: | WB, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
103,00 €
Artikelnummer: ELK-ES9327.100
Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The...
| Schlagworte: | Anti-RPL36AL, Anti-Ribosomal protein eL42-like, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein... |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €
Artikelnummer: CSB-PA01804B0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Schlagworte: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA01804C0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Schlagworte: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA01804D0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Schlagworte: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA01805B0Rb.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RPL36AL. Antigen Species: Human
| Schlagworte: | Anti-RPL36AL, Anti-60S ribosomal protein L36a-like, Anti-Large ribosomal subunit protein eL42-like, RPL36AL antibody, 60S... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €