Zu "GeneID 60386" wurden 12 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
SLC25A19 Protein, Human, Recombinant (His)
Artikelnummer: TGM-TMPH-02333-10ug
Description: Mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria. SLC25A19 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 37.0 kDa and the accession number is Q9HC21.
| Schlagworte: | Mitochondrial thiamine pyrophosphate transporter (MTPPT) , Mitochondrial thiamine pyrophosphate carrier , SLC25A19 , DNC ,... |
| MW: | 37 kD |
ab 510,00 €
Mitochondrial thiamine pyrophosphate carrier (SLC25A19),...
Artikelnummer: CSB-CF864025HU.100
Organism: Homo sapiens (Human). Source: in vitro E.coli expression system. Expression Region: 1-320aa. Protein Length: Full Length. Tag Info: N-terminal 10xHis-tagged. Target Protein Sequence: MVGYDPKPDG RNNTKFQVAV AGSVSGLVTR ALISPFDVIK IRFQLQHERL SRSDPSAKYH GILQASRQIL QEEGPTAFWK GHVPAQILSI GYGAVQFLSF EMLTELVHRG...
| Schlagworte: | DNC, SLC25A19, Mitochondrial uncoupling protein 1, Solute carrier family 25 member 19, Mitochondrial thiamine... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli in vitro |
| Ursprungsart: | human |
| MW: | 37.0 kD |
ab 1.458,00 €
SLC25A19 Protein, Human, Recombinant (His)
Artikelnummer: TGM-TMPH-02333-100ug
Description: Mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria. SLC25A19 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 37.0 kDa and the accession number is Q9HC21.
| Schlagworte: | SLC25A19, Solute carrier family 25 member 19, Mitochondrial thiamine pyrophosphate transporter, Mitochondrial uncoupling... |
| MW: | 37.0 kD |
ab 1.450,00 €
Anti-SLC25A19
Artikelnummer: ATA-HPA021936.100
Polyclonal Antibody against Human SLC25A19, Gene description: solute carrier family 25 member 19, Alternative Gene Names: DNC, MCPHA, MUP1, TPC, Validated applications: ICC, Uniprot ID: Q9HC21, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Mitochondrial...
| Schlagworte: | Anti-DNC, Anti-SLC25A19, Anti-Mitochondrial uncoupling protein 1, Anti-Solute carrier family 25 member 19,... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
NEU
Anti-SLC25A19
Artikelnummer: E-AB-65956.120
This gene encodes a mitochondrial protein that is a member of the solute carrier family. Although this protein was initially thought to be the mitochondrial deoxynucleotide carrier involved in the uptake of deoxynucleotides into the matrix of the mitochondria, further studies have demonstrated that this protein...
| Schlagworte: | Anti-DNC, Anti-SLC25A19, Anti-Solute carrier family 25 member 19, Anti-Mitochondrial uncoupling protein 1,... |
| Anwendung: | IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 243,00 €
Anti-SLC25A19
Artikelnummer: ATA-HPA021936.25
Polyclonal Antibody against Human SLC25A19, Gene description: solute carrier family 25 member 19, Alternative Gene Names: DNC, MCPHA, MUP1, TPC, Validated applications: ICC, Uniprot ID: Q9HC21, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Mitochondrial...
| Schlagworte: | Anti-DNC, Anti-SLC25A19, Anti-Mitochondrial uncoupling protein 1, Anti-Solute carrier family 25 member 19,... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
SLC25A19, Human solute carrier family 25 (mitochondrial...
Artikelnummer: VHPS-8494
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | DNC, SLC25A19, Solute carrier family 25 member 19, Mitochondrial uncoupling protein 1, Mitochondrial thiamine... |
| Anwendung: | RNA quantification |
45,00 €
Anti-SLC25A19, CT (SLC25A19, DNC, MUP1, Mitochondrial...
Artikelnummer: 041852.200
SLC25A19 encodes a mitochondrial protein that is a member of the solute carrier family. Although this protein was initially thought to be the mitochondrial deoxynucleotide carrier involved in the uptake of deoxynucleotides into the matrix of the mitochondria, further studies have demonstrated that this protein...
| Schlagworte: | Anti-DNC, Anti-SLC25A19, Anti-Mitochondrial uncoupling protein 1, Anti-Solute carrier family 25 member 19,... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
865,00 €
Anti-SLC25A19
Artikelnummer: NSJ-RQ6117
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Mitochondrial thiamine pyrophosphate carrier is a protein that in humans is encoded by the SLC25A19 gene. This gene encodes a mitochondrial protein that is a member of the solute carrier family. Although this protein was initially thought to be the mitochondrial...
| Schlagworte: | Anti-DNC, Anti-SLC25A19, Anti-Solute carrier family 25 member 19, Anti-Mitochondrial uncoupling protein 1,... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
790,00 €
Anti-SLC25A19
Artikelnummer: G-CAB12373.100
WB 1:500 - 1:2000, IF 1:50 - 1:200. Protein function: Mitochondrial transporter mediating uptake of thiamine pyrophosphate (ThPP) into mitochondria. [The UniProt Consortium]
| Schlagworte: | Anti-DNC, Anti-SLC25A19, Anti-Mitochondrial uncoupling protein 1, Anti-Solute carrier family 25 member 19,... |
| Anwendung: | WB, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 103,00 €
Anti-TPC
Artikelnummer: ELK-ES18865.100
Protein function: Mitochondrial transporter mediating uptake of thiamine diphosphate into mitochondria. It is not clear if the antiporter activity is affected by the membrane potential or by the proton electrochemical gradient. [The UniProt Consortium] Recommended dilutions: WB 1:1000-2000. Cellular localization:...
| Schlagworte: | Anti-MTPPT, Anti-Mitochondrial uncoupling protein 1, Anti-Solute carrier family 25 member 19, Anti-Mitochondrial thiamine... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
SLC25A19 PrEST Antigen
Artikelnummer: ATA-APrEST96009.100
PrEST Antigen SLC25A19, Gene description: solute carrier family 25 member 19, Alternative Gene Names: DNC, MCPHA, MUP1, TPC, Antigen sequence: PKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Schlagworte: | DNC, SLC25A19, Mitochondrial uncoupling protein 1, Solute carrier family 25 member 19, Mitochondrial thiamine... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €