Zu "GeneID 59351" wurden 11 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-PBOV1
Artikelnummer: E-AB-17415.120
This intronless gene encodes a protein of unknown function. Its expression is up-regulated in some types of cancer, including prostate, breast, and bladder cancer.
| Schlagworte: | Anti-UC28, Anti-PBOV1, Anti-UROC28, Anti-Protein UROC28, Anti-Prostate and breast cancer overexpressed gene 1 protein,... |
| Anwendung: | WB, IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 89,00 €
Anti-PBOV1
Artikelnummer: ATA-HPA063021.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 25% and to rat: 23%
| Schlagworte: | Anti-UC28, Anti-PBOV1, Anti-UROC28, Anti-Protein UROC28, Anti-Prostate and breast cancer overexpressed gene 1 protein |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Anti-PBOV1
Artikelnummer: CSB-PA191657.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: PBOV1. Antigen Species: Human
| Schlagworte: | Anti-UC28, Anti-PBOV1, Anti-UROC28, Anti-Protein UROC28, Anti-Prostate and breast cancer overexpressed gene 1 protein,... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 167,00 €
Anti-PBOV1
Artikelnummer: CSB-PA910949.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: PBOV1. Antigen Species: Human
| Schlagworte: | Anti-UC28, Anti-PBOV1, Anti-UROC28, Anti-Protein UROC28, Anti-Prostate and breast cancer overexpressed gene 1 protein,... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 167,00 €
Anti-PBOV1
Artikelnummer: ATA-HPA069649.100
Polyclonal Antibody against Human PBOV1, Gene description: prostate and breast cancer overexpressed 1, Alternative Gene Names: UC28, UROC28, Validated applications: ICC, Uniprot ID: Q9GZY1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 38% Rat gene...
| Schlagworte: | Anti-UC28, Anti-PBOV1, Anti-UROC28, Anti-Protein UROC28, Anti-Prostate and breast cancer overexpressed gene 1 protein |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
PBOV1, Human prostate and breast cancer overexpressed 1,...
Artikelnummer: VHPS-6658
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | UC28, PBOV1, UROC28, Protein UROC28, Prostate and breast cancer overexpressed gene 1 protein |
| Anwendung: | RNA quantification |
45,00 €
PBOV1 PrEST Antigen
Artikelnummer: ATA-APrEST88012.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | UC28, PBOV1, UROC28, Protein UROC28, Prostate and breast cancer overexpressed gene 1 protein |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-PBOV1
Artikelnummer: ABD-8C11669.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-PBOV1 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
| Schlagworte: | Anti-UC28, Anti-PBOV1, Anti-UROC28, Anti-Protein UROC28, Anti-Prostate and breast cancer overexpressed gene 1 protein,... |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
628,00 €
Anti-UROC28
Artikelnummer: ELK-ES7016.100
This intronless gene encodes a protein of unknown function. Its expression is up-regulated in some types of cancer, including prostate, breast, and bladder cancer. [provided by RefSeq, Aug 2011], Recommended dilutions: Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. Immunofluorescence: 1/200 -...
| Schlagworte: | Anti-UC28, Anti-PBOV1, Anti-UROC28, Anti-Protein UROC28, Anti-Prostate and breast cancer overexpressed gene 1 protein,... |
| Anwendung: | WB, IHC, IF, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €
Anti-PBOV1
Artikelnummer: CSB-PA040187.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | Anti-UC28, Anti-PBOV1, Anti-UROC28, Anti-Protein UROC28, Anti-Prostate and breast cancer overexpressed gene 1 protein,... |
| Anwendung: | ELISA, WB, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 126,00 €
PBOV1 PrEST Antigen
Artikelnummer: ATA-APrEST95683.100
PrEST Antigen PBOV1, Gene description: prostate and breast cancer overexpressed 1, Alternative Gene Names: UC28, UROC28, Antigen sequence: YSIEQSHHAILTPLQTHLTMKGSSMKCSSLSSEAILFT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 38% Rat gene identity: 38%
| Schlagworte: | UC28, PBOV1, UROC28, Protein UROC28, Prostate and breast cancer overexpressed gene 1 protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €