- Suchergebnis für GeneID 58530
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 58530" wurden 4 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: VHPS-5429
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: | LY6G6D, C6orf23, Protein Ly6-D, Lymphocyte antigen 6 complex locus protein G6d, Megakaryocyte-enhanced gene transcript 1... |
Anwendung: | RNA quantification |
43,00 €
Artikelnummer: 405978.100
Source:, Recombinant protein corresponding to aa10-104 from human lymphocyte Antigen 6 complex locus protein G6d, fused to His-B2M-JD-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.5kD, AA Sequence: LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS,...
Schlagworte: | LY6G6D, C6orf23, Protein Ly6-D, Lymphocyte antigen 6 complex locus protein G6d, Megakaryocyte-enhanced gene transcript 1... |
MW: | 15,5 |
ab 511,00 €
Artikelnummer: 517986.100
Source:, Recombinant protein corresponding to aa20-104 of human Lymphocyte Antigen 6 Complex Locus Protein G6d, fused to 10xHis-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~25.5kD, AA Sequence: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS, Storage and...
Schlagworte: | LY6G6D, C6orf23, Protein Ly6-D, Lymphocyte antigen 6 complex locus protein G6d, Megakaryocyte-enhanced gene transcript 1... |
Exprimiert in: | E.coli |
Ursprungsart: | human |
MW: | 25.5 kD |
ab 511,00 €
Artikelnummer: 374098.100
Source:, Recombinant protein corresponding to aa20-104 from human LY6G6D, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12kD, AA Sequence: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS, Storage and Stability: May be stored at 4°C for short-term only....
Schlagworte: | LY6G6D, C6orf23, Protein Ly6-D, Lymphocyte antigen 6 complex locus protein G6d, Megakaryocyte-enhanced gene transcript 1... |
MW: | 12 |
ab 531,00 €