- Suchergebnis für GeneID 57488
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 57488" wurden 11 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA002132.100
Protein function: Tethers the endoplasmic reticulum to the cell membrane and promotes the formation of appositions between the endoplasmic reticulum and the cell membrane. Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport. Plays a role in FGF signaling via its role in...
| Schlagworte: | Anti-E-Syt2, Anti-FAM62B, Anti-Chr2Syt, Anti-Extended synaptotagmin-2 |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 330,00 €
Artikelnummer: CSB-EP008279HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 191-662aa. Protein Length: Partial. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Target Protein Sequence: DTERAEWLNK TVKHMWPFIC QFIEKLFRET IEPAVRGANT HLSTFSFTKV DVGQQPLRIN GVKVYTENVD KRQIILDLQI SFVGNCEIDL EIKRYFCRAG VKSIQIHGTM...
| Schlagworte: | E-Syt2, FAM62B, Chr2Syt, Extended synaptotagmin-2, Recombinant Human Extended synaptotagmin-2 (ESYT2), partial |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 61.4 kD |
ab 292,00 €
Artikelnummer: ATA-HPA070823.100
Polyclonal Antibody against Human ESYT2, Gene description: extended synaptotagmin 2, Alternative Gene Names: CHR2SYT, FAM62B, KIAA1228, Validated applications: ICC, Uniprot ID: A0FGR8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Tethers the endoplasmic...
| Schlagworte: | Anti-FAM62B, Anti-E-Syt2, Anti-Chr2Syt, Anti-Extended synaptotagmin-2 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ABS-PP-5734-L.100
Protein function: Tethers the endoplasmic reticulum to the cell membrane and promotes the formation of appositions between the endoplasmic reticulum and the cell membrane. Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport. Plays a role in FGF signaling via its role in...
| Schlagworte: | Extended synaptotagmin-2, E-Syt2, Chr2Syt, Recombinant Human ESYT2 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 26.5 kD |
ab 115,00 €
Artikelnummer: ATA-APrEST85126.100
Protein function: Tethers the endoplasmic reticulum to the cell membrane and promotes the formation of appositions between the endoplasmic reticulum and the cell membrane. Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport. Plays a role in FGF signaling via its role in...
| Schlagworte: | E-Syt2, FAM62B, Chr2Syt, Extended synaptotagmin-2 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: CSB-PA008279LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ESYT2. Antigen Species: Human
| Schlagworte: | Anti-E-Syt2, Anti-FAM62B, Anti-Chr2Syt, Anti-Extended synaptotagmin-2, ESYT2 antibody, FAM62B antibody, KIAA1228Extended... |
| Anwendung: | ELISA, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA008279LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ESYT2. Antigen Species: Human
| Schlagworte: | Anti-E-Syt2, Anti-FAM62B, Anti-Chr2Syt, Anti-Extended synaptotagmin-2, ESYT2 antibody, FAM62B antibody, KIAA1228Extended... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA008279LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ESYT2. Antigen Species: Human
| Schlagworte: | Anti-E-Syt2, Anti-FAM62B, Anti-Chr2Syt, Anti-Extended synaptotagmin-2, ESYT2 antibody, FAM62B antibody, KIAA1228Extended... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA008279LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ESYT2. Antigen Species: Human
| Schlagworte: | Anti-E-Syt2, Anti-FAM62B, Anti-Chr2Syt, Anti-Extended synaptotagmin-2, ESYT2 antibody, FAM62B antibody, KIAA1228Extended... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: ABS-PP-5734.100
Protein function: Tethers the endoplasmic reticulum to the cell membrane and promotes the formation of appositions between the endoplasmic reticulum and the cell membrane. Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport. Plays a role in FGF signaling via its role in...
| Schlagworte: | Extended synaptotagmin-2, E-Syt2, Chr2Syt, Recombinant Human ESYT2 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 26.5 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95755.100
PrEST Antigen ESYT2, Gene description: extended synaptotagmin 2, Alternative Gene Names: CHR2SYT, FAM62B, KIAA1228, Antigen sequence: DHQHSAQVKRPSVSKEGRKTSIKSHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEKAQPPEAGPQGLHDQGRSSS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Tethers the...
| Schlagworte: | FAM62B, E-Syt2, Chr2Syt, Extended synaptotagmin-2 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €