Zu "GeneID 57349" wurden 16 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Mouse CXCL7 / NAP2 ELISA Kit
Artikelnummer: ARG81724.96
| Schlagworte: | Thymus chemokine 1, Platelet basic protein, Pro-platelet basic protein, Chemokine subfamily B Cys-X-Cys, Chemokine (C-X-C... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
1.118,00 €
CXCL7 Protein, Mouse, Recombinant (aa 40-113, His)
Artikelnummer: TGM-TMPY-00218-50ug
Description: CXCL7 Protein, Mouse, Recombinant (aa 40-113, His) is expressed in E. coli expression system with His tag. The predicted molecular weight is 10.4 kDa and the accession number is Q9EQI5.
| Schlagworte: | b-TG1, NAP-2, pro-platelet basic protein (chemokine (C-X-C motif) ligand 7), MDGF, LA-PF4, Cxcl7, NAP-2-L1, CTAPIII, TGB,... |
| MW: | 10.4 kD |
505,00 €
Recombinant Mouse CXCL7 Protein(Trx Tag)
Artikelnummer: E-PDEM100165.1
Pro-platelet basic protein (PPBP) is also known as Chemokine (C-X-C motif) ligand 7 (CXCL7) and nucleosome assembly protein (Nap-2). Nap-2 / PPBP / CXCL7 is released in large amounts from platelets following their activation and is a platelet-derived growth factor that belongs to the CXC chemokine family. This...
| Schlagworte: | Ppbp, Recombinant Mouse CXCL7 Protein(Trx Tag) |
ab 192,00 €
NEU
CXCL7 Protein, Mouse, Recombinant (aa 40-113, His)
Artikelnummer: TGM-TMPY-00218-10ug
Description: CXCL7 Protein, Mouse, Recombinant (aa 40-113, His) is expressed in E. coli expression system with His tag. The predicted molecular weight is 10.4 kDa and the accession number is Q9EQI5.
| Schlagworte: | b-TG1 , pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) , NAP-2 , Cxcl7 , CTAPIII , NAP-2-L1 , MDGF , LA-PF4... |
| MW: | 10.4 kD |
ab 82,00 €
Mouse BetaTG/PBP/CXCL7/NAP2 (Thromboglobulin, Beta)...
Artikelnummer: G-AEES05197.480
Mouse BetaTG/PBP/CXCL7/NAP2 (Thromboglobulin, Beta) Superset Max DIY ELISA
| Schlagworte: | Ppbp |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
919,00 €
CXCL7, mouse recombinant (rmoCXCL7)
Artikelnummer: RP1935M-005
Produced in Yeast. Amino acid sequence: KSDGMDPYIE LRCRCTNTIS GIPFNSISLV NVYRPGVHCA DVEVIATLKN GQKTCLDPNA PGVKRIVMKI LEGY (74).
| Schlagworte: | Thymus chemokine 1, Platelet basic protein, Pro-platelet basic protein, Chemokine subfamily B Cys-X-Cys |
| Anwendung: | Bioassays |
| Exprimiert in: | Yeast |
| Ursprungsart: | mouse |
| MW: | 8.1 kD |
ab 233,00 €
-10 %
Rabattaktion
QuicKey Pro Mouse CXCL7 (Thromboglobulin, Beta) ELISA Kit
Artikelnummer: E-OSEL-M0022.24
PPBP, slso named as NAP2, or beta-Thromboglobulin, is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis,...
| Schlagworte: | Thymus chemokine 1, Platelet basic protein, Chemokine subfamily B Cys-X-Cys |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
122,00 €
ab 109,80 €
Anti-NAP-2 / CXCL7 / PPBP
Artikelnummer: NSJ-RQ4113
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Chemokine (C-X-C motif) ligand 7 (CXCL7), also known as NAP2 or Pro-Platelet basic protein (PPBP), is a human gene. The protein encoded by this gene is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent...
| Schlagworte: | Anti-Thymus chemokine 1, Anti-Platelet basic protein, Anti-Pro-platelet basic protein, Anti-Chemokine subfamily B... |
| Anwendung: | WB, IHC (paraffin), ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
790,00 €
Beta-Thromboglobulin (bTG) BioAssay(TM) ELISA Kit (Mouse)
Artikelnummer: 023697.96
Beta-Thromboglobulin (bTG) BioAssay(TM) ELISA Kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of bTG in mouse serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. Detection Range: 1.56-100pg/ml, Sensitivity: 0.69pg/ml, Intra-Assay CV: <10%,...
| Schlagworte: | Protein Ppbp, Thymus chemokine 1, Platelet basic protein, Pro-platelet basic protein, Chemokine subfamily B Cys-X-Cys,... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
1.048,00 €
CXCL7 (40-113) protein(N-His)(active) (recombinant mouse)
Artikelnummer: E-PKSM041515.100
Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <1 µg/mL. Sequence: MGFRLRPTSSCTRACPLHNLQILLLLGLILVALAPLTAGKSDGMDPYIELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKILEGY. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by...
| Schlagworte: | Thymus chemokine 1, Platelet basic protein, Pro-platelet basic protein, Chemokine subfamily B Cys-X-Cys, Recombinant Mouse... |
| Anwendung: | Active, cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 13.08 kD |
ab 241,00 €
CXCL7 (48-109) protein(N-His)(active) (recombinant mouse)
Artikelnummer: E-PKSM041516.100
Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <5 ng/mL. Sequence: MGFRLRPTSSCTRACPLHNLQILLLLGLILVALAPLTAGKSDGMDPYIELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKILEGY. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by...
| Schlagworte: | Thymus chemokine 1, Platelet basic protein, Pro-platelet basic protein, Chemokine subfamily B Cys-X-Cys, Recombinant Mouse... |
| Anwendung: | Active, cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 13.08 kD |
ab 241,00 €
-10 %
Rabattaktion
Uncoated Mouse betaTG/PBP/CXCL7/NAP2(Thromboglobulin,...
Artikelnummer: E-UNEL-M0083.15
Colormetric. Detection Range: 31.25-2000 pg/mL.
| Schlagworte: | Thymus chemokine 1, Platelet basic protein, Pro-platelet basic protein, Chemokine subfamily B Cys-X-Cys |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
485,00 €
ab 436,50 €