Zu "GeneID 56673" wurden 8 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-C11orf16
Anti-C11orf16

Artikelnummer: ATA-HPA040644.100

Polyclonal Antibody against Human C11orf16, Gene description: chromosome 11 open reading frame 16, Validated applications: ICC, Uniprot ID: Q9NQ32, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 27% Rat gene identity: 27%
Schlagworte: Anti-C11orf16, Anti-Uncharacterized protein C11orf16
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
Anti-C11orf16
Anti-C11orf16

Artikelnummer: ATA-HPA040644.25

Polyclonal Antibody against Human C11orf16, Gene description: chromosome 11 open reading frame 16, Validated applications: ICC, Uniprot ID: Q9NQ32, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 27% Rat gene identity: 27%
Schlagworte: Anti-C11orf16, Anti-Uncharacterized protein C11orf16
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
361,00 €
Bewerten
C11orf16, Human chromosome 11 open reading frame 16, Real Time PCR Primer Set
C11orf16, Human chromosome 11 open reading frame 16, Real...

Artikelnummer: VHPS-964

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: C11orf16 C11orf16
Anwendung: RNA quantification
45,00 €
Bewerten
Anti-CK016
Anti-CK016

Artikelnummer: ELK-ES17437.100

Recommended dilutions: WB 1:500-2000. Cellular localization:
Schlagworte: Anti-C11orf16, Anti- C11orf16, CK016 rabbit pAb
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
ab 173,00 €
Bewerten
C11orf16 (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pU
C11orf16 (Vector Vector will be determined during the...

Artikelnummer: CSB-CL865100HU.10

Length: 1215 Sequence: atggaatcct ccacggggcc caggatgcct ttgctcaaat actgcagcgt ggccacaagc ctgaaggccc ctggctggga cggtgctgct ccaccttggg acctctcctt cacctacccc tttgccctcc aagcaccctg gctcaccggg cacaagcccc ttgcaaggca tgcctcttct tgcccatgtc tccacgttgc cgacccagca tggcaggggc ctggctggct gggaagagct ggagatgctg ccaacacatg...
Schlagworte: C11orf16, Uncharacterized protein C11orf16
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
176,00 €
Bewerten
C11orf16 (human), recombinant protein
C11orf16 (human), recombinant protein

Artikelnummer: ABS-PP-9985.100

Schlagworte: Uncharacterized protein C11orf16, Recombinant Human C11orf16 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 18 kD
ab 90,00 €
Bewerten
C11orf16 PrEST Antigen
C11orf16 PrEST Antigen

Artikelnummer: ATA-APrEST95631.100

PrEST Antigen C11orf16, Gene description: chromosome 11 open reading frame 16, Antigen sequence: WRYWKRNGPEPCPGKPGTRYSNICKEEKDHKQQRAQTVVVGTTKELVSKATHMKPPQTPPGEAEHRKRSQSLAICQWN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 27% Rat gene identity: 27%
Schlagworte: C11orf16, Uncharacterized protein C11orf16
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
C11orf16 (human), recombinant protein
C11orf16 (human), recombinant protein

Artikelnummer: ABS-PP-9985-L.100

Schlagworte: Uncharacterized protein C11orf16, Recombinant Human C11orf16 Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 18 kD
ab 115,00 €
Bewerten