- Suchergebnis für GeneID 56519
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 56519" wurden 6 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: G-MOFI00220.96
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
698,00 €
Artikelnummer: CSB-EP305482MO.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 23-63aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: QIINNPITCM TNGAICWGPC PTAFRQIGNC GHFKVRCCKI R. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test....
| Schlagworte: | BD-4, Bdef4, Defb4, mBD-4, Beta-defensin 4, Defensin, beta 4, Recombinant Mouse Beta-defensin 4 (Defb4) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 20.6 kD |
ab 292,00 €
Artikelnummer: TGM-TMPH-02544-100ug
Description: Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to mouse (but not human) CCR6 and induce chemotactic activity of CCR6-expressing cells. DEFB4 Protein, Mouse, Recombinant (His & SUMO) is expressed in...
| Schlagworte: | mBD-4, Defb4, Defensin, beta 4, Bdef4, BD-4, Beta-defensin 4 |
| MW: | 20.6 kD |
ab 266,00 €
Artikelnummer: TGM-TMPH-02544-10ug
Description: Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to mouse (but not human) CCR6 and induce chemotactic activity of CCR6-expressing cells. DEFB4 Protein, Mouse, Recombinant (His & SUMO) is expressed in...
| Schlagworte: | Defb4 , Defensin, beta 4 , BD-4 , Beta-defensin 4 , Bdef4 , mBD-4 |
| MW: | 20.6 kD |
ab 99,00 €
Artikelnummer: 373031.100
Has bactericidal activity. Source: Recombinant protein corresponding to aa23-63 from mouse Defb4, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~20.6kD, AA Sequence: QIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to...
| Schlagworte: | BD-4, Bdef4, mBD-4, Defb4, Beta-defensin 4, Defensin, beta 4 |
| MW: | 20,6 |
ab 690,00 €
Artikelnummer: CSB-PA305482ZA01MO.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-BD-4, Anti-Defb4, Anti-mBD-4, Anti-Bdef4, Anti-Beta-defensin 4, Anti-Defensin, beta 4, Defb4 Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Mus musculus (Mouse) |
ab 1.529,00 €