- Suchergebnis für GeneID 54954
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 54954" wurden 9 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA047677.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 77% and to rat: 73%
| Schlagworte: | Anti-CXorf17, Anti-FAM120C, Anti-Protein FAM120C, Anti-Tumor antigen BJ-HCC-21, Anti-Constitutive coactivator of... |
| Anwendung: | ICC, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: ATA-HPA054250.100
Polyclonal Antibody against Human FAM120C, Gene description: family with sequence similarity 120C, Alternative Gene Names: CXorf17, FLJ20506, ORF34, Validated applications: ICC, Uniprot ID: Q9NX05, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 73% Rat...
| Schlagworte: | Anti-FAM120C, Anti-CXorf17, Anti-Protein FAM120C, Anti-Tumor antigen BJ-HCC-21, Anti-Constitutive coactivator of... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA054250.25
Polyclonal Antibody against Human FAM120C, Gene description: family with sequence similarity 120C, Alternative Gene Names: CXorf17, FLJ20506, ORF34, Validated applications: ICC, Uniprot ID: Q9NX05, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 73% Rat...
| Schlagworte: | Anti-FAM120C, Anti-CXorf17, Anti-Protein FAM120C, Anti-Tumor antigen BJ-HCC-21, Anti-Constitutive coactivator of... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: VHPS-3140
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | FAM120C, CXorf17, Protein FAM120C, Tumor antigen BJ-HCC-21, Constitutive coactivator of PPAR-gamma-like protein 2 |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: ATA-APrEST84841.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | CXorf17, FAM120C, Protein FAM120C, Tumor antigen BJ-HCC-21, Constitutive coactivator of PPAR-gamma-like protein 2 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: CSB-CL873676HU.10
Length: 399 Sequence: atggaacgcc atgctgggct acttgtcagc gctgtgccag gcttgtgcct atcctggcgg cgacggcctg gagctcgtgg tcatgttccc ggggggcctg ggcaaggacc ggctggccga gtggggccgt cggtgccagg ccgagcggca gacagcgcaa ctgatcgtgg gacacgtggg caacaagggc acccctccac cgcgggcctg gttcctgcca ccggcctgcc tgagccactg cgtgaggcta gcactcatcc...
| Schlagworte: | CXorf17, FAM120C, Protein FAM120C, Tumor antigen BJ-HCC-21, Constitutive coactivator of PPAR-gamma-like protein 2 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €
Artikelnummer: ABS-PP-2842.100
| Schlagworte: | Constitutive coactivator of PPAR-gamma-like protein 2, Protein FAM120C, Tumor antigen BJ-HCC-21, Recombinant Human FAM120C... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 18 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95866.100
PrEST Antigen FAM120C, Gene description: family with sequence similarity 120C, Alternative Gene Names: CXorf17, FLJ20506, ORF34, Antigen sequence: NWAVSYDSSASQFPNYLPSKASPPLGPDSSHSSSSDGDEPNGASSDHITEAFHHQPEWGNPNRDRGSWAQPVDTGVSEA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene...
| Schlagworte: | CXorf17, FAM120C, Protein FAM120C, Tumor antigen BJ-HCC-21, Constitutive coactivator of PPAR-gamma-like protein 2 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ABS-PP-2842-L.100
| Schlagworte: | Constitutive coactivator of PPAR-gamma-like protein 2, Protein FAM120C, Tumor antigen BJ-HCC-21, Recombinant Human FAM120C... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 18 kD |
ab 115,00 €