Zu "GeneID 54854" wurden 5 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-FAM83E
Artikelnummer: ATA-HPA049305.100
Protein function: May play a role in MAPK signaling. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 79% and to rat: 78%
| Schlagworte: | Anti-Protein FAM83E |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Anti-FAM83E
Artikelnummer: ATA-HPA075968.100
Polyclonal Antibody against Human FAM83E, Gene description: family with sequence similarity 83 member E, Alternative Gene Names: FLJ20200, Validated applications: ICC, Uniprot ID: Q2M2I3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May play a role in...
| Schlagworte: | Anti-Protein FAM83E |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
FAM83E, Human family with sequence similarity 83, member...
Artikelnummer: VHPS-3176
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | FAM83E, Protein FAM83E |
| Anwendung: | RNA quantification |
45,00 €
FAM83E PrEST Antigen
Artikelnummer: ATA-APrEST82578.100
Protein function: May play a role in MAPK signaling. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | Protein FAM83E |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
FAM83E PrEST Antigen
Artikelnummer: ATA-APrEST95750.100
PrEST Antigen FAM83E, Gene description: family with sequence similarity 83 member E, Alternative Gene Names: FLJ20200, Antigen sequence: DNELKKSWGSKDTPAKALMRQRGTGGGPWGEVDSRPPWGGALPLPPAHRLRYLSPARRRFGGDATFKLQEP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May play a role...
| Schlagworte: | Protein FAM83E |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
