Zu "GeneID 54752" wurden 8 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-FNDC8
Artikelnummer: ATA-HPA026521.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 53% and to rat: 52%
| Schlagworte: | Anti-FNDC8, Anti-Fibronectin type III domain-containing protein 8 |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Anti-FNDC8
Artikelnummer: ATA-HPA059803.100
Polyclonal Antibody against Human FNDC8, Gene description: fibronectin type III domain containing 8, Alternative Gene Names: DKFZp434H2215, Validated applications: ICC, Uniprot ID: Q8TC99, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 72% Rat gene...
| Schlagworte: | Anti-FNDC8, Anti-Fibronectin type III domain-containing protein 8 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
FNDC8 (human), recombinant protein
Artikelnummer: ABS-PP-9760-L.100
| Schlagworte: | Fibronectin type III domain-containing protein 8, Recombinant Human FNDC8 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 18.5 kD |
ab 115,00 €
FNDC8, Human fibronectin type III domain containing 8,...
Artikelnummer: VHPS-3366
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | FNDC8, Fibronectin type III domain-containing protein 8 |
| Anwendung: | RNA quantification |
45,00 €
Anti-FNDC8, ID (FNDC8, Fibronectin type III...
Artikelnummer: 035704.200
Applications:, Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product,...
| Schlagworte: | Anti-FNDC8, Anti-Fibronectin type III domain-containing protein 8 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
FNDC8 PrEST Antigen
Artikelnummer: ATA-APrEST75528.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | FNDC8, Fibronectin type III domain-containing protein 8 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
FNDC8 (human), recombinant protein
Artikelnummer: ABS-PP-9760.100
| Schlagworte: | Fibronectin type III domain-containing protein 8, Recombinant Human FNDC8 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 18.5 kD |
ab 90,00 €
FNDC8 PrEST Antigen
Artikelnummer: ATA-APrEST96089.100
PrEST Antigen FNDC8, Gene description: fibronectin type III domain containing 8, Alternative Gene Names: DKFZp434H2215, Antigen sequence: EVAKTQENELPEAKNRPWIFNKILGTTVKLMELKPNTCYCLSVRAANTAGVGKWCKPYKFATLATDFSSFPENYPIQITVRRKEPRQKIVSIGPEEMRRLEDLEYLFPC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
| Schlagworte: | FNDC8, Fibronectin type III domain-containing protein 8 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €