- Suchergebnis für GeneID 54537
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 54537" wurden 9 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: CSB-PA597588.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Schlagworte: | Anti-Protein FAM35A, Anti-Shield complex subunit 2, Anti-Shieldin complex subunit 2, Anti-RINN1-REV7-interacting novel... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
284,00 €
Artikelnummer: ATA-HPA057506.100
Polyclonal Antibody against Human SHLD2, Gene description: shieldin complex subunit 2, Alternative Gene Names: bA163M19.1, FAM35A, FAM35A1, MGC5560, RINN2, Validated applications: IHC, Uniprot ID: Q86V20, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Schlagworte: | Anti-Protein FAM35A, Anti-Shield complex subunit 2, Anti-Shieldin complex subunit 2, Anti-RINN1-REV7-interacting novel... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
NEU
Artikelnummer: ATA-HPA057506.25
Polyclonal Antibody against Human SHLD2, Gene description: shieldin complex subunit 2, Alternative Gene Names: bA163M19.1, FAM35A, FAM35A1, MGC5560, RINN2, Validated applications: IHC, Uniprot ID: Q86V20, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Schlagworte: | Anti-Protein FAM35A, Anti-Shield complex subunit 2, Anti-Shieldin complex subunit 2, Anti-RINN1-REV7-interacting novel... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: ABS-PP-2403-L.100
Protein function: Component of the shieldin complex, which plays an important role in repair of DNA double-stranded breaks (DSBs) (PubMed:29656893, PubMed:29789392). During G1 and S phase of the cell cycle, the complex functions downstream of TP53BP1 to promote non-homologous end joining (NHEJ) and suppress DNA end...
| Schlagworte: | Shieldin complex subunit 2, Protein FAM35A, RINN1-REV7-interacting novel NHEJ regulator 2, Shield complex subunit 2,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 19.5 kD |
ab 115,00 €
Artikelnummer: VHPS-3161
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | FAM35A, Protein FAM35A |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: CSB-PA030133.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | Anti-Protein FAM35A, Anti-Shield complex subunit 2, Anti-Shieldin complex subunit 2, Anti-RINN1-REV7-interacting novel... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 126,00 €
Artikelnummer: CSB-CL771442HU.10
Length: 2508 Sequence: atgagtggag gatctcaagt ccacattttt tggggtgctc caattgctcc actgaaaatc acagtatcag aagacacagc ttctttaatg tctgttgctg acccctggaa aaaaattcag cttttataca gtcaacattc tttatatctg aaggatgaaa aacagcacaa aaatcttgaa aactataaag tcccagaatc tattggttct ccagatctta gtggtcattt cttagcaaac tgtatgaata gacatgttca...
| Schlagworte: | Protein FAM35A, Shield complex subunit 2, Shieldin complex subunit 2, RINN1-REV7-interacting novel NHEJ regulator 2 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
911,00 €
Artikelnummer: ABS-PP-2403.100
Protein function: Component of the shieldin complex, which plays an important role in repair of DNA double-stranded breaks (DSBs) (PubMed:29656893, PubMed:29789392). During G1 and S phase of the cell cycle, the complex functions downstream of TP53BP1 to promote non-homologous end joining (NHEJ) and suppress DNA end...
| Schlagworte: | Shieldin complex subunit 2, Protein FAM35A, RINN1-REV7-interacting novel NHEJ regulator 2, Shield complex subunit 2,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 19.5 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95845.100
PrEST Antigen SHLD2, Gene description: shieldin complex subunit 2, Alternative Gene Names: bA163M19.1, FAM35A, FAM35A1, MGC5560, RINN2, Antigen sequence: ISTDTEFLSIITSSQVAFLAQKKDKRRSPVNKGNVNMETEPKASYGEIRIPEENSIQLDGFTEAYESGQNQAYSLEL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Schlagworte: | Protein FAM35A, Shield complex subunit 2, Shieldin complex subunit 2, RINN1-REV7-interacting novel NHEJ regulator 2 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €