Zu "GeneID 54537" wurden 8 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-FAM35AFAM35/B
Artikelnummer: CSB-PA597588.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Schlagworte: | Anti-Protein FAM35A, Anti-Shield complex subunit 2, Anti-Shieldin complex subunit 2, Anti-RINN1-REV7-interacting novel... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
284,00 €
Anti-SHLD2
Artikelnummer: ATA-HPA057506.100
Polyclonal Antibody against Human SHLD2, Gene description: shieldin complex subunit 2, Alternative Gene Names: bA163M19.1, FAM35A, FAM35A1, MGC5560, RINN2, Validated applications: IHC, Uniprot ID: Q86V20, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Schlagworte: | Anti-Protein FAM35A, Anti-Shield complex subunit 2, Anti-Shieldin complex subunit 2, Anti-RINN1-REV7-interacting novel... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
SHLD2 (human), recombinant protein
Artikelnummer: ABS-PP-2403-L.100
Protein function: Component of the shieldin complex, which plays an important role in repair of DNA double-stranded breaks (DSBs) (PubMed:29656893, PubMed:29789392). During G1 and S phase of the cell cycle, the complex functions downstream of TP53BP1 to promote non-homologous end joining (NHEJ) and suppress DNA end...
| Schlagworte: | Shieldin complex subunit 2, Protein FAM35A, RINN1-REV7-interacting novel NHEJ regulator 2, Shield complex subunit 2,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 19.5 kD |
ab 115,00 €
FAM35A, Human family with sequence similarity 35, member...
Artikelnummer: VHPS-3161
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | FAM35A, Protein FAM35A |
| Anwendung: | RNA quantification |
45,00 €
Anti-FAM35A
Artikelnummer: CSB-PA030133.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | Anti-Protein FAM35A, Anti-Shield complex subunit 2, Anti-Shieldin complex subunit 2, Anti-RINN1-REV7-interacting novel... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 126,00 €
FAM35A (Vector pUC, Accession No. BC051863)
Artikelnummer: CSB-CL771442HU.10
Length: 2508 Sequence: atgagtggag gatctcaagt ccacattttt tggggtgctc caattgctcc actgaaaatc acagtatcag aagacacagc ttctttaatg tctgttgctg acccctggaa aaaaattcag cttttataca gtcaacattc tttatatctg aaggatgaaa aacagcacaa aaatcttgaa aactataaag tcccagaatc tattggttct ccagatctta gtggtcattt cttagcaaac tgtatgaata gacatgttca...
| Schlagworte: | Protein FAM35A, Shield complex subunit 2, Shieldin complex subunit 2, RINN1-REV7-interacting novel NHEJ regulator 2 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
911,00 €
SHLD2 (human), recombinant protein
Artikelnummer: ABS-PP-2403.100
Protein function: Component of the shieldin complex, which plays an important role in repair of DNA double-stranded breaks (DSBs) (PubMed:29656893, PubMed:29789392). During G1 and S phase of the cell cycle, the complex functions downstream of TP53BP1 to promote non-homologous end joining (NHEJ) and suppress DNA end...
| Schlagworte: | Shieldin complex subunit 2, Protein FAM35A, RINN1-REV7-interacting novel NHEJ regulator 2, Shield complex subunit 2,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 19.5 kD |
ab 90,00 €
SHLD2 PrEST Antigen
Artikelnummer: ATA-APrEST95845.100
PrEST Antigen SHLD2, Gene description: shieldin complex subunit 2, Alternative Gene Names: bA163M19.1, FAM35A, FAM35A1, MGC5560, RINN2, Antigen sequence: ISTDTEFLSIITSSQVAFLAQKKDKRRSPVNKGNVNMETEPKASYGEIRIPEENSIQLDGFTEAYESGQNQAYSLEL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Schlagworte: | Protein FAM35A, Shield complex subunit 2, Shieldin complex subunit 2, RINN1-REV7-interacting novel NHEJ regulator 2 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €