- Suchergebnis für GeneID 5288
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 5288" wurden 10 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: G-PACO07210.50
PIK3C2G Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, WB applications. PIK3C2G Antibody is a high quality polyclonal antibody for research use only.. Protein function: Generates phosphatidylinositol 3-phosphate (PtdIns3P) and phosphatidylinositol...
| Schlagworte: | Anti-PIK3C2G, EC=2.7.1.154, Anti-PI3K-C2-gamma, Anti-PtdIns-3-kinase C2 subunit gamma, Anti-Phosphoinositide... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
225,00 €
Artikelnummer: CSB-PA782930.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | Anti-PIK3C2G, EC=2.7.1.154, Anti-PI3K-C2-gamma, Anti-PtdIns-3-kinase C2 subunit gamma, Anti-Phosphoinositide... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 126,00 €
Artikelnummer: ATA-HPA077589.100
Polyclonal Antibody against Human PIK3C2G, Gene description: phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 gamma, Validated applications: ICC, Uniprot ID: O75747, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Generates...
| Schlagworte: | Anti-PIK3C2G, EC=2.7.1.154, Anti-PI3K-C2-gamma, Anti-PtdIns-3-kinase C2 subunit gamma, Anti-Phosphoinositide... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA077589.25
Polyclonal Antibody against Human PIK3C2G, Gene description: phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 gamma, Validated applications: ICC, Uniprot ID: O75747, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Generates...
| Schlagworte: | Anti-PIK3C2G, EC=2.7.1.154, Anti-PI3K-C2-gamma, Anti-PtdIns-3-kinase C2 subunit gamma, Anti-Phosphoinositide... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: VHPS-6888
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | PIK3C2G, EC=2.7.1.154, PI3K-C2-gamma, PtdIns-3-kinase C2 subunit gamma, Phosphoinositide 3-kinase-C2-gamma,... |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: P4186-23F.200
PI3KC2G belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2...
| Schlagworte: | EC=2.7.1.154, Anti-PtdIns-3-kinase C2 subunit gamma, Anti-Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing... |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Artikelnummer: ELK-ES8365.100
The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain...
| Schlagworte: | Anti-PIK3C2G, Anti-PI3K-C2-gamma, Anti-PtdIns-3-kinase C2 subunit gamma, Anti-Phosphoinositide 3-kinase-C2-gamma,... |
| Anwendung: | WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €
Artikelnummer: ABS-PP-5858.100
Protein function: Generates phosphatidylinositol 3-phosphate (PtdIns3P) and phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4)P2) that act as second messengers. May play a role in SDF1A-stimulated chemotaxis. [The UniProt Consortium]
| Schlagworte: | Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma, PI3K-C2-gamma, PtdIns-3-kinase C2 subunit gamma,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 11.5 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95607.100
PrEST Antigen PIK3C2G, Gene description: phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 gamma, Antigen sequence: PNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGKIPHYESEIDENTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELSWHQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Schlagworte: | PIK3C2G, EC=2.7.1.154, PI3K-C2-gamma, PtdIns-3-kinase C2 subunit gamma, Phosphoinositide 3-kinase-C2-gamma,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ABS-PP-5858-L.100
Protein function: Generates phosphatidylinositol 3-phosphate (PtdIns3P) and phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4)P2) that act as second messengers. May play a role in SDF1A-stimulated chemotaxis. [The UniProt Consortium]
| Schlagworte: | Phosphatidylinositol 3-kinase C2 domain-containing subunit gamma, PI3K-C2-gamma, PtdIns-3-kinase C2 subunit gamma,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 11.5 kD |
ab 115,00 €