Zu "GeneID 51368" wurden 9 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-TEX264
Artikelnummer: ATA-HPA017739.100
Protein function: Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538,...
| Schlagworte: | Anti-Testis-expressed protein 264, Anti-Putative secreted protein Zsig11 |
| Anwendung: | ICC, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 330,00 €
Anti-TEX264
Artikelnummer: ATA-HPA073223.100
Polyclonal Antibody against Human TEX264, Gene description: testis expressed 264, ER-phagy receptor, Alternative Gene Names: FLJ13935, ZSIG11, Validated applications: ICC, Uniprot ID: Q9Y6I9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Major...
| Schlagworte: | Anti-Testis-expressed protein 264, Anti-Putative secreted protein Zsig11 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
NEU
Anti-TEX264
Artikelnummer: ATA-HPA073223.25
Polyclonal Antibody against Human TEX264, Gene description: testis expressed 264, ER-phagy receptor, Alternative Gene Names: FLJ13935, ZSIG11, Validated applications: ICC, Uniprot ID: Q9Y6I9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Major...
| Schlagworte: | Anti-Testis-expressed protein 264, Anti-Putative secreted protein Zsig11 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
241,00 €
TEX264 (human), recombinant protein
Artikelnummer: ABS-PP-3416-L.100
Protein function: Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538,...
| Schlagworte: | Testis-expressed protein 264, Putative secreted protein Zsig11, Recombinant Human TEX264 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 13.5 kD |
ab 115,00 €
ZSIG11, Human, Real Time PCR Primer Set
Artikelnummer: VHPS-10337
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | ZSIG11, TEX264, Putative secreted protein Zsig11, Testis-expressed sequence 264 protein |
| Anwendung: | RNA quantification |
45,00 €
TEX264 PrEST Antigen
Artikelnummer: ATA-APrEST72149.100
Protein function: Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538,...
| Schlagworte: | Testis-expressed protein 264, Putative secreted protein Zsig11 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-TX264
Artikelnummer: ELK-ES12484.100
Protein function: Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538,...
| Schlagworte: | Anti-Testis-expressed protein 264, Anti-Putative secreted protein Zsig11, TX264 rabbit pAb |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €
TEX264 (human), recombinant protein
Artikelnummer: ABS-PP-3416.100
Protein function: Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538,...
| Schlagworte: | Testis-expressed protein 264, Putative secreted protein Zsig11, Recombinant Human TEX264 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 13.5 kD |
ab 90,00 €
TEX264 PrEST Antigen
Artikelnummer: ATA-APrEST96222.100
PrEST Antigen TEX264, Gene description: testis expressed 264, ER-phagy receptor, Alternative Gene Names: FLJ13935, ZSIG11, Antigen sequence: PSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Schlagworte: | Testis-expressed protein 264, Putative secreted protein Zsig11 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €