- Suchergebnis für GeneID 51368
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 51368" wurden 9 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA017739.100
Protein function: Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538,...
| Schlagworte: | Anti-Testis-expressed protein 264, Anti-Putative secreted protein Zsig11 |
| Anwendung: | ICC, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 330,00 €
Artikelnummer: ATA-HPA073223.100
Polyclonal Antibody against Human TEX264, Gene description: testis expressed 264, ER-phagy receptor, Alternative Gene Names: FLJ13935, ZSIG11, Validated applications: ICC, Uniprot ID: Q9Y6I9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Major...
| Schlagworte: | Anti-Testis-expressed protein 264, Anti-Putative secreted protein Zsig11 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
NEU
Artikelnummer: ATA-HPA073223.25
Polyclonal Antibody against Human TEX264, Gene description: testis expressed 264, ER-phagy receptor, Alternative Gene Names: FLJ13935, ZSIG11, Validated applications: ICC, Uniprot ID: Q9Y6I9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Major...
| Schlagworte: | Anti-Testis-expressed protein 264, Anti-Putative secreted protein Zsig11 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
241,00 €
Artikelnummer: ABS-PP-3416-L.100
Protein function: Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538,...
| Schlagworte: | Testis-expressed protein 264, Putative secreted protein Zsig11, Recombinant Human TEX264 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 13.5 kD |
ab 115,00 €
Artikelnummer: VHPS-10337
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | ZSIG11, TEX264, Putative secreted protein Zsig11, Testis-expressed sequence 264 protein |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: ATA-APrEST72149.100
Protein function: Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538,...
| Schlagworte: | Testis-expressed protein 264, Putative secreted protein Zsig11 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ELK-ES12484.100
Protein function: Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538,...
| Schlagworte: | Anti-Testis-expressed protein 264, Anti-Putative secreted protein Zsig11, TX264 rabbit pAb |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat, mouse, |
ab 173,00 €
Artikelnummer: ABS-PP-3416.100
Protein function: Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538,...
| Schlagworte: | Testis-expressed protein 264, Putative secreted protein Zsig11, Recombinant Human TEX264 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 13.5 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST96222.100
PrEST Antigen TEX264, Gene description: testis expressed 264, ER-phagy receptor, Alternative Gene Names: FLJ13935, ZSIG11, Antigen sequence: PSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Schlagworte: | Testis-expressed protein 264, Putative secreted protein Zsig11 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €