Zu "GeneID 51021" wurden 16 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-MRPS16
Anti-MRPS16

Artikelnummer: ATA-HPA050081.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 89% and to rat: 88%
Schlagworte: Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: WB, IHC, ICC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 246,00 €
Bewerten
Anti-MRPS16
Anti-MRPS16

Artikelnummer: ATA-HPA054538.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 94% and to rat: 95%
Schlagworte: Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: WB, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 369,00 €
Bewerten
28S ribosomal protein S16, mitochondrial (MRPS16), human, recombinant
28S ribosomal protein S16, mitochondrial (MRPS16), human,...

Artikelnummer: CSB-EP897105HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-137aa. Protein Length: Full Length. Tag Info: N-terminal GST-tagged. Target Protein Sequence: VAAHNKCPRD GRFVEQLGSY DPLPNSHGEK LVALNLDRIR HWIGCGAHLS KPMEKLLGLA GFFPLHPMMI TNAERLRRKR AREVLLASQK TDAEATDTEA TET. Purity: Greater than 90% as determined...
Schlagworte: S16mt, MRPS16, RPMS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit...
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: human
MW: 38.5 kD
ab 292,00 €
Bewerten
Anti-MRPS16
Anti-MRPS16

Artikelnummer: CSB-PA869890.100

Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
Schlagworte: Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: ELISA, WB, IHC
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
284,00 €
Bewerten
Anti-MRPS16
Anti-MRPS16

Artikelnummer: E-AB-62435.120

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
Schlagworte: Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
ab 243,00 €
Bewerten
MRPS16, Recombinant, Human, aa1-137, GST-Tag (28S Ribosomal Protein S16, Mitochondrial)
MRPS16, Recombinant, Human, aa1-137, GST-Tag (28S...

Artikelnummer: 374275.100

Source:, Recombinant protein corresponding to aa1-137 from human MRPS16, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.5kD, AA Sequence: VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET, Storage and Stability: May be stored at 4°C...
Schlagworte: S16mt, MRPS16, RPMS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit...
MW: 38,5
ab 690,00 €
Bewerten
MRPS16, Human mitochondrial ribosomal protein S16, Real Time PCR Primer Set
MRPS16, Human mitochondrial ribosomal protein S16, Real...

Artikelnummer: VHPS-5861

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: S16mt, RPMS16, MRPS16, MRP-S16, 28S ribosomal protein S16, mitochondrial
Anwendung: RNA quantification
45,00 €
Bewerten
MRPS16 PrEST Antigen
MRPS16 PrEST Antigen

Artikelnummer: ATA-APrEST84675.100

Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: S16mt, RPMS16, MRPS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit...
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
MRPS16 PrEST Antigen
MRPS16 PrEST Antigen

Artikelnummer: ATA-APrEST84676.100

Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: S16mt, RPMS16, MRPS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit...
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
Anti-MRPS16
Anti-MRPS16

Artikelnummer: G-CAB9874.100

Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
ab 103,00 €
Bewerten
Anti-MRPS16
Anti-MRPS16

Artikelnummer: ABD-8C14035.50

Custom conjugation services for this antibody as available (eg. labeling of Anti-MRPS16 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
Schlagworte: Anti-S16mt, Anti-MRPS16, Anti-RPMS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: WB, IHC, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
628,00 €
Bewerten
Anti-MRPS16
Anti-MRPS16

Artikelnummer: CSB-PA020255.100

Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Schlagworte: Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-28S ribosomal protein S16, mitochondrial,...
Anwendung: ELISA, WB, IHC
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
ab 126,00 €
Bewerten
1 von 2 Seiten