- Suchergebnis für GeneID 51021
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 51021" wurden 16 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA050081.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 89% and to rat: 88%
| Schlagworte: | Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,... |
| Anwendung: | WB, IHC, ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Artikelnummer: ATA-HPA054538.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 94% and to rat: 95%
| Schlagworte: | Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,... |
| Anwendung: | WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: CSB-EP897105HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-137aa. Protein Length: Full Length. Tag Info: N-terminal GST-tagged. Target Protein Sequence: VAAHNKCPRD GRFVEQLGSY DPLPNSHGEK LVALNLDRIR HWIGCGAHLS KPMEKLLGLA GFFPLHPMMI TNAERLRRKR AREVLLASQK TDAEATDTEA TET. Purity: Greater than 90% as determined...
| Schlagworte: | S16mt, MRPS16, RPMS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 38.5 kD |
ab 292,00 €
Artikelnummer: CSB-PA869890.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Schlagworte: | Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-28S ribosomal protein S16, mitochondrial,... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
284,00 €
Artikelnummer: E-AB-62435.120
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
| Schlagworte: | Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-28S ribosomal protein S16, mitochondrial,... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 243,00 €
Artikelnummer: 374275.100
Source:, Recombinant protein corresponding to aa1-137 from human MRPS16, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.5kD, AA Sequence: VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET, Storage and Stability: May be stored at 4°C...
| Schlagworte: | S16mt, MRPS16, RPMS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit... |
| MW: | 38,5 |
ab 690,00 €
Artikelnummer: VHPS-5861
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | S16mt, RPMS16, MRPS16, MRP-S16, 28S ribosomal protein S16, mitochondrial |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: ATA-APrEST84675.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | S16mt, RPMS16, MRPS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ATA-APrEST84676.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | S16mt, RPMS16, MRPS16, CGI-132, MRP-S16, 28S ribosomal protein S16, mitochondrial, Mitochondrial small ribosomal subunit... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: G-CAB9874.100
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 103,00 €
Artikelnummer: ABD-8C14035.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-MRPS16 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
| Schlagworte: | Anti-S16mt, Anti-MRPS16, Anti-RPMS16, Anti-CGI-132, Anti-MRP-S16, Anti-28S ribosomal protein S16, mitochondrial,... |
| Anwendung: | WB, IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
628,00 €
Artikelnummer: CSB-PA020255.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | Anti-S16mt, Anti-RPMS16, Anti-MRPS16, Anti-MRP-S16, Anti-CGI-132, Anti-28S ribosomal protein S16, mitochondrial,... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 126,00 €