- Suchergebnis für GeneID 474354
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 474354" wurden 12 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: G-PACO38790.50
LRRC18 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. LRRC18 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May be involved in the regulation of spermatogenesis and sperm maturation. [The UniProt...
| Schlagworte: | Anti-LRRC18, Anti-Leucine-rich repeat-containing protein 18 |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
313,00 €
Artikelnummer: ATA-HPA039256.100
Protein function: May be involved in the regulation of spermatogenesis and sperm maturation. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 64% and to rat: 64%
| Schlagworte: | Anti-LRRC18, Anti-Leucine-rich repeat-containing protein 18 |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Artikelnummer: ATA-HPA076699.100
Polyclonal Antibody against Human LRRC18, Gene description: leucine rich repeat containing 18, Alternative Gene Names: MGC34773, UNQ933, UNQ9338, VKGE9338, Validated applications: ICC, Uniprot ID: Q8N456, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May...
| Schlagworte: | Anti-LRRC18, Anti-Leucine-rich repeat-containing protein 18 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA076699.25
Polyclonal Antibody against Human LRRC18, Gene description: leucine rich repeat containing 18, Alternative Gene Names: MGC34773, UNQ933, UNQ9338, VKGE9338, Validated applications: ICC, Uniprot ID: Q8N456, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May...
| Schlagworte: | Anti-LRRC18, Anti-Leucine-rich repeat-containing protein 18 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: 037919.200
May be involved in the regulation of spermatogenesis and sperm maturation (By similarity). Applications: Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:50-100, Storage and Stability: May be stored at 4°C for...
| Schlagworte: | Anti-LRRC18, Anti-Leucine-rich repeat-containing protein 18 |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
865,00 €
Artikelnummer: ATA-APrEST80316.100
Protein function: May be involved in the regulation of spermatogenesis and sperm maturation. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | LRRC18, Leucine-rich repeat-containing protein 18 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: CSB-CL839794HU.10
Length: 786 Sequence: atggttaagg gtgagaaagg ccccaagggc aagaagatca ccctcaaggt ggccaggaat tgcatcaaaa tcacttttga tgggaaaaag cgccttgact tgagcaagat gggaattacc accttcccca agtgtattct gcgccttagt gacatggacg agctggacct tagccggaat cttatcagga agatccctga ctccatctcc aagttccaga acctccggtg gctggacctg cacagcaact acatagacaa...
| Schlagworte: | LRRC18, Leucine-rich repeat-containing protein 18 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
176,00 €
Artikelnummer: CSB-PA839794LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LRRC18. Antigen Species: Human
| Schlagworte: | Anti-LRRC18, Anti-Leucine-rich repeat-containing protein 18, LRRC18 antibody, UNQ9338/PRO34010 antibody, Leucine-rich... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA839794LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LRRC18. Antigen Species: Human
| Schlagworte: | Anti-LRRC18, Anti-Leucine-rich repeat-containing protein 18, LRRC18 antibody, UNQ9338/PRO34010 antibody, Leucine-rich... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA839794LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LRRC18. Antigen Species: Human
| Schlagworte: | Anti-LRRC18, Anti-Leucine-rich repeat-containing protein 18, LRRC18 antibody, UNQ9338/PRO34010 antibody, Leucine-rich... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA839794LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: LRRC18. Antigen Species: Human
| Schlagworte: | Anti-LRRC18, Anti-Leucine-rich repeat-containing protein 18, LRRC18 antibody, UNQ9338/PRO34010 antibody, Leucine-rich... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: ATA-APrEST95713.100
PrEST Antigen LRRC18, Gene description: leucine rich repeat containing 18, Alternative Gene Names: MGC34773, UNQ933, UNQ9338, VKGE9338, Antigen sequence: PVELKQLKNIRAVNLGLNHLDSVPTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPGES, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Schlagworte: | LRRC18, Leucine-rich repeat-containing protein 18 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €