Zu "GeneID 4010" wurden 22 Artikel gefunden!

Artikelnummer: CSB-PA106950.100

Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...

Schlagworte:	Anti-LMX1B, Anti-LMX-1.2, Anti-LIM/homeobox protein 1.2, Anti-LIM/homeobox protein LMX1B, Anti-LIM homeobox transcription...
Anwendung:	ELISA, WB
Wirt:	Rabbit
Spezies-Reaktivität:	human, mouse

283,00 €

Human LIM homeobox transcription factor 1-beta / LMX1B...

Artikelnummer: G-HUFI01239.96

Anwendung:	ELISA
Spezies-Reaktivität:	human

641,00 €

Artikelnummer: ATA-HPA073716.100

Protein function: Essential for the specification of dorsal limb fate at both the zeugopodal and autopodal levels. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 67% and to rat: 100%

Schlagworte:	Anti-LMX1B, Anti-LMX-1.2, Anti-LIM/homeobox protein 1.2, Anti-LIM/homeobox protein LMX1B, Anti-LIM homeobox transcription...
Anwendung:	ICC
Wirt:	Rabbit
Spezies-Reaktivität:	human

ab 239,00 €

LMX1B (human), recombinant protein

Artikelnummer: ABS-PP-1951.100

Schlagworte:	LIM homeobox transcription factor 1-beta, LIM/homeobox protein 1.2, LMX-1.2, LIM/homeobox protein LMX1B, Recombinant Human...
MW:	27 kD

ab 90,00 €

LMX1B PrEST Antigen

Artikelnummer: ATA-APrEST95979.100

PrEST Antigen LMX1B, Gene description: LIM homeobox transcription factor 1 beta, Alternative Gene Names: NPS1, Antigen sequence: YEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Essential for the specification of dorsal limb fate...

Schlagworte:	LMX1B, LMX-1.2, LIM/homeobox protein 1.2, LIM/homeobox protein LMX1B, LIM homeobox transcription factor 1-beta
Exprimiert in:	E.coli
Ursprungsart:	human

265,00 €

LMX1B (Vector Vector will be determined during the...

Artikelnummer: CSB-CL013019HU1.10

Length: 1119 Sequence: atgttggacg gcatcaagat ggaggagcac gccctgcgcc ccgggcccgc cactctgggg gtgctgctgg gctccgactg cccgcatccc gccgtctgcg agggctgcca gcggcccatc tccgaccgct tcctgatgcg agtcaacgag tcgtcctggc acgaggagtg tttgcagtgc gcggcgtgtc agcaagccct caccaccagc tgctacttcc gggatcggaa actgtactgc aaacaagact accaacagct...

Schlagworte:	LMX1B, LMX-1.2, LIM/homeobox protein 1.2, LIM/homeobox protein LMX1B, LIM homeobox transcription factor 1-beta
Anwendung:	Molecular biology, clone
Spezies-Reaktivität:	human

176,00 €

LMX1B (Vector Vector will be determined during the...

Artikelnummer: CSB-CL013019HU2.10

Schlagworte:	LMX1B, LMX-1.2, LIM/homeobox protein 1.2, LIM/homeobox protein LMX1B, LIM homeobox transcription factor 1-beta
Anwendung:	Molecular biology, clone
Spezies-Reaktivität:	human

176,00 €

Artikelnummer: CSB-PA009846.100

Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...

Schlagworte:	Anti-LMX1B, Anti-LMX-1.2, Anti-LIM/homeobox protein 1.2, Anti-LIM/homeobox protein LMX1B, Anti-LIM homeobox transcription...
Anwendung:	ELISA, WB, IHC
Wirt:	Rabbit
Spezies-Reaktivität:	human, mouse

ab 126,00 €

Artikelnummer: 600-401-CL7

Anti-LMX1B Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. At least three isoforms are known to exist. This antibody is predicted to not cross-react with LMX1A. Protein function: Essential for the specification of dorsal limb fate at both the zeugopodal and autopodal...

Schlagworte:	Anti-LMX1B, Anti-LMX-1.2, Anti-LIM/homeobox protein 1.2, Anti-LIM/homeobox protein LMX1B, Anti-LIM homeobox transcription...
Anwendung:	ELISA, IHC, IFM, WB
Wirt:	Rabbit
Spezies-Reaktivität:	human, mouse, rat

834,00 €

LMX1B, Human LIM homeobox transcription factor 1, beta,...

Artikelnummer: VHPS-5335

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....

Schlagworte:	LMX1B, LMX1B protein
Anwendung:	RNA quantification

44,00 €

Anti-LMX 1.2 (homeobox transcription factor 1 beta,...

Artikelnummer: L2200-02.50

LMX-1.2 is essential for the specification of dorsal limb fate. It is expressed in most of tissues, with highest levels in testis, thyroid, duodenum, skeletal muscle, and pancreatic islets. Defects in LMX-1.2 are the cause of nail-patella syndrome (NPS), also known as Onychoosteodysplasia. NPS is a disease that...

Schlagworte:	Anti-LIM homeobox transcription factor 1-beta
Anwendung:	ELISA, WB
Wirt:	Mouse
Spezies-Reaktivität:	human

637,00 €