- Suchergebnis für GeneID 397208
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 397208" wurden 15 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ARG70212.20
Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [The UniProt Consortium]
| Schlagworte: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Anwendung: | SDS-PAGE, cell culture |
| Ursprungsart: | swine |
ab 432,00 €
Artikelnummer: G-AEES05441.480
Porcine GM-CSF (Granulocyte Macrophage Colony Stimulating Factor) Superset Max DIY ELISA Protein Function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes [The Uniprot Consortium]
| Schlagworte: | CSF2, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
919,00 €
Artikelnummer: CR-C03018-100UG
Sequence: APTRPPSPVT RPWQHVDAIK EALSLLNNSN DTAAVMNETV DVVCEMFDPQ EPTCVQTRLN LYKQGLRGSL TRLKSPLTLL AKHYEQHCPL ETSCETQSIT FKSFKDSLNK FLFTIPFDCW with polyhistidine tag at the N-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Cytokine that stimulates the growth and...
| Schlagworte: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Anwendung: | Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
ab 312,00 €
Artikelnummer: RP0940S-025
Produced in Yeast. Amino acid sequence: APTRPPSPVT RPWQHVDAIK EALSLLNNSN DTAAVMNETV DVVCEMFDPQ EPTCVQTRLN LYKQGLRGSL TRLKSPLTLL AKHYEQHCPL TEETSCETQS ITFKSFKDSL NKFLFTIPFD CWGPVKK (127).
| Schlagworte: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Anwendung: | Bioassays |
| Exprimiert in: | Yeast |
| Ursprungsart: | swine |
| MW: | 14,4 kD |
ab 233,00 €
Artikelnummer: ARG82961.96
Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [The UniProt Consortium]
| Schlagworte: | CSF, CSF, CSF2, GM-CSF, GM-CSF, Colony-stimulating factor, Colony-stimulating factor, Granulocyte-macrophage... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
929,00 €
Artikelnummer: E-PKSS000024.20
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <3 ng/mL. Sequence: MWLQNLLLLGTVVCSISAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK. Fusion tag: N-His Endotoxin: Please contact us for...
| Schlagworte: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor, Recombinant Swine GM-CSF... |
| Anwendung: | Active, Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
| MW: | 17.08 kD |
435,00 €
Artikelnummer: E-PKSS000024.5
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <3 ng/mL. Sequence: MWLQNLLLLGTVVCSISAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK. Fusion tag: N-His Endotoxin: Please contact us for...
| Schlagworte: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor, Recombinant Swine GM-CSF... |
| Anwendung: | Active, cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
| MW: | 17.08 kD |
192,00 €
Artikelnummer: G-AEFI00782.96
ELISA Type: Sandwich ELISA, Double Antibody. Detection Range: 15.625-1000µg/mL. Sensitivity: 9.375µg/mL. Sample Types: Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples. Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from...
| Schlagworte: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Anwendung: | Sandwich ELISA, Double Antibody |
| Spezies-Reaktivität: | swine |
698,00 €
Artikelnummer: G-RPES6867.5
Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [The UniProt Consortium]
| Schlagworte: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Exprimiert in: | E.coli |
306,00 €
Artikelnummer: E-KAB-0622.1
Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [The UniProt Consortium]
| Schlagworte: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor, Porcine GM-CSF Antibody... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
1.093,00 €
Artikelnummer: E-UNEL-P0015.1440
Type: Sandwich-ELISA. Detection Range: 1.56-100 pg/mL. Sensitivity: . Tested Sample Types: Serum, plasma. Test principle: Protein function: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and...
| Schlagworte: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
ab 485,00 €
Artikelnummer: DIY2245S-003
The Swine GM-CSF ELISA contains capture antibody, standard, and detection antibody for development of a Swine GM-CSF ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods for the ELISA...
| Schlagworte: | CSF, CSF2, GM-CSF, Colony-stimulating factor, Granulocyte-macrophage colony-stimulating factor |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
ab 1.098,00 €