Zu "GeneID 389658" wurden 13 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ALKAL1
Anti-ALKAL1

Artikelnummer: ATA-HPA027368.100

Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 65% and to rat: 70%
Schlagworte: Anti-FAM150A, Anti-AUG-beta, Anti-Augmentor beta, Anti-Protein FAM150A, Anti-ALK and LTK ligand 1
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 369,00 €
Bewerten
ALK and LTK ligand 1 (ALKAL1), human, recombinant
ALK and LTK ligand 1 (ALKAL1), human, recombinant

Artikelnummer: CSB-BP757795HU.1

Organism: Homo sapiens (Human). Source: Baculovirus. Expression Region: 28-129aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Target Protein Sequence: RPRGRRGARV TDKEPKPLLF LPAAGAGRTP SGSRSAEIFP RDSNLKDKFI KHFTGPVTFS PECSKHFHRL YYNTRECSTP AYYKRCARLL...
Schlagworte: FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1, Recombinant Human ALK and LTK ligand 1 (ALKAL1)
Anwendung: Activity not tested
Exprimiert in: Insect cells
Ursprungsart: human
MW: 15.4 kD
ab 489,00 €
Bewerten
ALK and LTK ligand 1 (ALKAL1), human, recombinant
ALK and LTK ligand 1 (ALKAL1), human, recombinant

Artikelnummer: CSB-EP757795HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 28-129aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-B2M-tagged. Target Protein Sequence: RPRGRRGARV TDKEPKPLLF LPAAGAGRTP SGSRSAEIFP RDSNLKDKFI KHFTGPVTFS PECSKHFHRL YYNTRECSTP AYYKRCARLL TRLAVSPLCS QT. Purity: Greater...
Schlagworte: FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1, Recombinant Human ALK and LTK ligand 1 (ALKAL1)
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: human
MW: 25.5 kD
ab 292,00 €
Bewerten
FAM150A Protein, Human, Recombinant (mFc)
FAM150A Protein, Human, Recombinant (mFc)

Artikelnummer: TGM-TMPY-04317-100ug

Description: FAM150A Protein, Human, Recombinant (mFc) is expressed in HEK293 mammalian cells with mFc tag. The predicted molecular weight is 37.93 kDa and the accession number is Q6UXT8.
Schlagworte: FAM150A, UNQ9433, family with sequence similarity 150 member A
MW: 37.93 kD
768,00 €
Bewerten
FAM150A Protein, Human, Recombinant (mFc)
FAM150A Protein, Human, Recombinant (mFc)

Artikelnummer: TGM-TMPY-04317-10ug

Description: FAM150A Protein, Human, Recombinant (mFc) is expressed in HEK293 mammalian cells with mFc tag. The predicted molecular weight is 37.93 kDa and the accession number is Q6UXT8.
Schlagworte: FAM150A , UNQ9433 , family with sequence similarity 150 member A
MW: 37.93 kD
ab 75,00 €
Bewerten
Protein FAM150A, Recombinant, Human, aa28-129, His-SUMO-Tag (FAM150A)
Protein FAM150A, Recombinant, Human, aa28-129,...

Artikelnummer: 374877.100

Source:, Recombinant protein corresponding to aa28-129 from human FAM150A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.5kD, AA Sequence: RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT, Storage and Stability: May be stored...
Schlagworte: FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1
MW: 27,5
ab 690,00 €
Bewerten
ALKAL1 (human), recombinant protein
ALKAL1 (human), recombinant protein

Artikelnummer: ABS-PQ-869-L.100

Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium]
Schlagworte: ALK and LTK ligand 1, Augmentor beta, AUG-beta, Recombinant Human ALKAL1 Protein
Exprimiert in: human cells
Ursprungsart: human
MW: 12.5 kD
ab 295,00 €
Bewerten
ALKAL1 PrEST Antigen
ALKAL1 PrEST Antigen

Artikelnummer: ATA-APrEST76439.100

Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
Human FAM150A Protein (Fc Tag)
Human FAM150A Protein (Fc Tag)

Artikelnummer: E-PKSH030534.100

Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium]
Ursprungsart: human
924,00 €
Bewerten
Recombinant Human FAM150A Protein (Fc Tag) (RPES3663)
Recombinant Human FAM150A Protein (Fc Tag) (RPES3663)

Artikelnummer: G-RPES3663.100

Human FAM150A Recombinant Protein (RPES3663) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium]
Schlagworte: FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1
Exprimiert in: Human cells
Ursprungsart: human
1.471,00 €
Bewerten
FAM150A (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC
FAM150A (Vector Vector will be determined during the...

Artikelnummer: CSB-CL757795HU.10

Length: 390 Sequence: atgcggcccc ttaagcccgg cgcccctttg cccgcactct tcctgctggc gctggctttg tccccgcacg gagcccacgg gaggccccgg gggcgcaggg gagcgcgcgt cacggataag gagcccaagc cgttgctttt cctccccgcg gccggggccg gccggactcc cagcggctcc cggagcgcag aaatattccc aagagactct aacttaaaag acaaattcat aaagcatttc acagggccgg tcacattttc...
Schlagworte: FAM150A, AUG-beta, Augmentor beta, Protein FAM150A, ALK and LTK ligand 1
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
176,00 €
Bewerten
ALKAL1 (human), recombinant protein
ALKAL1 (human), recombinant protein

Artikelnummer: ABS-PQ-869.100

Protein function: Ligand for receptor tyrosine kinase LTK and perhaps receptor tyrosine kinase ALK, activation of ALK is reported conflictingly. [The UniProt Consortium]
Schlagworte: ALK and LTK ligand 1, Augmentor beta, AUG-beta, Recombinant Human ALKAL1 Protein
Exprimiert in: human cells
Ursprungsart: human
MW: 12.5 kD
ab 270,00 €
Bewerten
1 von 2 Seiten