- Suchergebnis für GeneID 3783
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 3783" wurden 24 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA013367.100
Polyclonal Antibody against Human KCNN4, Gene description: potassium calcium-activated channel subfamily N member 4, Alternative Gene Names: hIKCa1, hKCa4, hSK4, IK, KCa3.1, Validated applications: ICC, Uniprot ID: O15554, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C....
Schlagworte: | Anti-IK1, Anti-SK4, Anti-KCa4, Anti-IKCa1, Anti-KCNN4, Anti-SKCa4, Anti-KCa3.1, Anti-SKCa 4, Anti-Putative Gardos channel,... |
Anwendung: | ICC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
450,00 €
Artikelnummer: CSB-CF012086HU.100
Organism: Homo sapiens (Human). Source: in vitro E.coli expression system. Expression Region: 1-427aa. Protein Length: Full Length. Tag Info: N-terminal 10xHis-tagged. Target Protein Sequence: MGGDLVLGLG ALRRRKRLLE QEKSLAGWAL VLAGTGIGLM VLHAEMLWFG GCSWALYLFL VKCTISISTF LLLCLIVAFH AKEVQLFMTD NGLRDWRVAL TGRQAAQIVL...
Schlagworte: | IK1, SK4, KCa4, IKCa1, SKCa4, KCNN4, KCa3.1, SKCa 4, Putative Gardos channel, Intermediate conductance calcium-activated... |
Anwendung: | Activity not tested |
Exprimiert in: | E.coli in vitro |
Ursprungsart: | human |
MW: | 53.7 kD |
ab 1.458,00 €
Artikelnummer: CSB-PA484256.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: KCNN4. Antigen Species: Human
Schlagworte: | Anti-SK4, Anti-IK1, Anti-KCa4, Anti-IKCa1, Anti-KCNN4, Anti-SKCa4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
Anwendung: | ELISA, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA980762.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: KCNN4. Antigen Species: Human
Schlagworte: | Anti-SK4, Anti-IK1, Anti-KCa4, Anti-IKCa1, Anti-KCNN4, Anti-SKCa4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
Anwendung: | ELISA, WB, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
ab 167,00 €
Artikelnummer: E-AB-13359.120
The protein encoded by this gene is part of a potentially heterotetrameric voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane hyperpolarization, which promotes calcium influx. The encoded protein may be part of the predominant calcium-activated...
Schlagworte: | Anti-IK1, Anti-SK4, Anti-KCa4, Anti-KCNN4, Anti-IKCa1, Anti-SKCa4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
Anwendung: | IHC, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 89,00 €
Artikelnummer: NSJ-RQ4583
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Intermediate conductance calcium-activated potassium channel protein 1 (KCNN4, Kca3.1) is part of a potentially heterotetrameric voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane...
Schlagworte: | Anti-SK4, Anti-IK1, Anti-KCa4, Anti-KCNN4, Anti-IKCa1, Anti-SKCa4, Anti-KCa3.1, Anti-SKCa 4, Anti-Putative Gardos channel,... |
Anwendung: | WB, Direct ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
772,00 €
Artikelnummer: ARG42195.50
Protein function: Forms a voltage-independent potassium channel that is activated by intracellular calcium (PubMed:26148990). Activation is followed by membrane hyperpolarization which promotes calcium influx. Required for maximal calcium influx and proliferation during the reactivation of naive T-cells...
Schlagworte: | Anti-SK4, Anti-IK1, Anti-KCa4, Anti-SKCa4, Anti-IKCa1, Anti-KCNN4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
Anwendung: | WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
551,00 €
Artikelnummer: ATA-HPA053841.100
Protein function: Forms a voltage-independent potassium channel that is activated by intracellular calcium (PubMed:26148990). Activation is followed by membrane hyperpolarization which promotes calcium influx. Required for maximal calcium influx and proliferation during the reactivation of naive T-cells...
Schlagworte: | Anti-IK1, Anti-SK4, Anti-KCa4, Anti-KCNN4, Anti-IKCa1, Anti-SKCa4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
Anwendung: | IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 320,00 €
Artikelnummer: ATA-HPA059622.100
Protein function: Forms a voltage-independent potassium channel that is activated by intracellular calcium (PubMed:26148990). Activation is followed by membrane hyperpolarization which promotes calcium influx. Required for maximal calcium influx and proliferation during the reactivation of naive T-cells...
Schlagworte: | Anti-IK1, Anti-SK4, Anti-KCa4, Anti-KCNN4, Anti-IKCa1, Anti-SKCa4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
Anwendung: | IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 320,00 €
Artikelnummer: ELK-EA302.50
Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Protein function: Forms a voltage-independent potassium channel that is activated by intracellular calcium (PubMed:26148990). Activation is followed by membrane hyperpolarization...
Schlagworte: | Anti-IK1, Anti-SK4, Anti-KCa4, Anti-SKCa4, Anti-KCNN4, Anti-IKCa1, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
Anwendung: | WB, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
173,00 €
Artikelnummer: NSJ-RQ7087
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Intermediate conductance calcium-activated potassium channel protein 1 (KCNN4, Kca3.1) is part of a potentially heterotetrameric voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane...
Schlagworte: | Anti-IK1, Anti-SK4, Anti-KCa4, Anti-KCNN4, Anti-IKCa1, Anti-SKCa4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
Anwendung: | WB, Direct ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
772,00 €

Artikelnummer: ATA-APrEST96183.100
PrEST Antigen KCNN4, Gene description: potassium calcium-activated channel subfamily N member 4, Alternative Gene Names: hIKCa1, hKCa4, hSK4, IK, KCa3.1, Antigen sequence: LQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQ, Storage: Upon delivery store at...
Schlagworte: | IK1, SK4, KCa4, KCNN4, SKCa4, IKCa1, KCa3.1, SKCa 4, Putative Gardos channel, Intermediate conductance calcium-activated... |
Exprimiert in: | E.coli |
Ursprungsart: | human |
265,00 €