- Suchergebnis für GeneID 344905
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 344905" wurden 9 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA031771.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 77% and to rat: 73%
| Schlagworte: | Anti-ATP13A5, EC=7.2.2.-, Anti-P5-ATPase isoform 5, Anti-Probable cation-transporting ATPase 13A5 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Artikelnummer: ATA-HPA031774.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 83% and to rat: 81%
| Schlagworte: | Anti-ATP13A5, EC=7.2.2.-, Anti-P5-ATPase isoform 5, Anti-Probable cation-transporting ATPase 13A5 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Artikelnummer: ATA-HPA031772.100
Polyclonal Antibody against Human ATP13A5, Gene description: ATPase 13A5, Alternative Gene Names: FLJ16025, Validated applications: ICC, Uniprot ID: Q4VNC0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 72% Rat gene identity: 72%
| Schlagworte: | Anti-ATP13A5, EC=7.2.2.-, Anti-P5-ATPase isoform 5, Anti-Probable cation-transporting ATPase 13A5 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ABS-PP-3686-L.100
| Schlagworte: | Probable cation-transporting ATPase 13A5, P5-ATPase isoform 5, Recombinant Human ATP13A5 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 45.5 kD |
ab 115,00 €
Artikelnummer: ATA-APrEST77754.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | ATP13A5, EC=7.2.2.-, P5-ATPase isoform 5, Probable cation-transporting ATPase 13A5 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ATA-APrEST77755.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | ATP13A5, EC=7.2.2.-, P5-ATPase isoform 5, Probable cation-transporting ATPase 13A5 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ELK-ES18221.100
Recommended dilutions: WB 1:500-2000. Cellular localization: Membrane , Multi-pass membrane protein .
| Schlagworte: | Anti-ATP13A5, EC=7.2.2.-, Anti-P5-ATPase isoform 5, Anti-Probable cation-transporting ATPase 13A5, AT135 rabbit pAb |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
Artikelnummer: ABS-PP-3686.100
| Schlagworte: | Probable cation-transporting ATPase 13A5, P5-ATPase isoform 5, Recombinant Human ATP13A5 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 45.5 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95842.100
PrEST Antigen ATP13A5, Gene description: ATPase 13A5, Alternative Gene Names: FLJ16025, Antigen sequence: FGFYSKSQYRTWQKKLAEDSTWPPINRTDYSGDGKNGFYINGGYESHEQIPKRKLKLGGQPTEQHFWAR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 72% Rat gene identity: 72%
| Schlagworte: | ATP13A5, EC=7.2.2.-, P5-ATPase isoform 5, Probable cation-transporting ATPase 13A5 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €