Zu "GeneID 344905" wurden 9 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ATP13A5
Artikelnummer: ATA-HPA031771.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 77% and to rat: 73%
| Schlagworte: | Anti-ATP13A5, EC=7.2.2.-, Anti-P5-ATPase isoform 5, Anti-Probable cation-transporting ATPase 13A5 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Anti-ATP13A5
Artikelnummer: ATA-HPA031774.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 83% and to rat: 81%
| Schlagworte: | Anti-ATP13A5, EC=7.2.2.-, Anti-P5-ATPase isoform 5, Anti-Probable cation-transporting ATPase 13A5 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Anti-ATP13A5
Artikelnummer: ATA-HPA031772.100
Polyclonal Antibody against Human ATP13A5, Gene description: ATPase 13A5, Alternative Gene Names: FLJ16025, Validated applications: ICC, Uniprot ID: Q4VNC0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 72% Rat gene identity: 72%
| Schlagworte: | Anti-ATP13A5, EC=7.2.2.-, Anti-P5-ATPase isoform 5, Anti-Probable cation-transporting ATPase 13A5 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
ATP13A5 (human), recombinant protein
Artikelnummer: ABS-PP-3686-L.100
| Schlagworte: | Probable cation-transporting ATPase 13A5, P5-ATPase isoform 5, Recombinant Human ATP13A5 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 45.5 kD |
ab 115,00 €
ATP13A5 PrEST Antigen
Artikelnummer: ATA-APrEST77754.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | ATP13A5, EC=7.2.2.-, P5-ATPase isoform 5, Probable cation-transporting ATPase 13A5 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
ATP13A5 PrEST Antigen
Artikelnummer: ATA-APrEST77755.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | ATP13A5, EC=7.2.2.-, P5-ATPase isoform 5, Probable cation-transporting ATPase 13A5 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-AT135
Artikelnummer: ELK-ES18221.100
Recommended dilutions: WB 1:500-2000. Cellular localization: Membrane , Multi-pass membrane protein .
| Schlagworte: | Anti-ATP13A5, EC=7.2.2.-, Anti-P5-ATPase isoform 5, Anti-Probable cation-transporting ATPase 13A5, AT135 rabbit pAb |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
ATP13A5 (human), recombinant protein
Artikelnummer: ABS-PP-3686.100
| Schlagworte: | Probable cation-transporting ATPase 13A5, P5-ATPase isoform 5, Recombinant Human ATP13A5 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 45.5 kD |
ab 90,00 €
ATP13A5 PrEST Antigen
Artikelnummer: ATA-APrEST95842.100
PrEST Antigen ATP13A5, Gene description: ATPase 13A5, Alternative Gene Names: FLJ16025, Antigen sequence: FGFYSKSQYRTWQKKLAEDSTWPPINRTDYSGDGKNGFYINGGYESHEQIPKRKLKLGGQPTEQHFWAR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 72% Rat gene identity: 72%
| Schlagworte: | ATP13A5, EC=7.2.2.-, P5-ATPase isoform 5, Probable cation-transporting ATPase 13A5 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €