Zu "GeneID 343521" wurden 6 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-TCTEX1D4
Artikelnummer: ATA-HPA062652.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 79% and to rat: 81%
| Schlagworte: | Anti-TCTEX1D4, Anti-Tctex-2-beta, Anti-Protein N22.1, Anti-Dynein light chain Tctex-type 4, Anti-Tctex1 domain-containing... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Anti-DYNLT4
Artikelnummer: ATA-HPA050116.100
Polyclonal Antibody against Human DYNLT4, Gene description: dynein light chain Tctex-type 4, Alternative Gene Names: TCTEX1D4, Validated applications: ICC, Uniprot ID: Q5JR98, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 74% Rat gene identity: 74%
| Schlagworte: | Anti-TCTEX1D4, Anti-Tctex-2-beta, Anti-Protein N22.1, Anti-Dynein light chain Tctex-type 4, Anti-Tctex1 domain-containing... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
463,00 €
Anti-TDRG1
Artikelnummer: 600-401-FB5
Anti-TDRG1 Antibody was affinity purified from monospecific antiserum by immunoaffinity chromatography. TDRG1 antibody is human reactive.
| Schlagworte: | Anti-TCTEX1D4, Anti-Tctex-2-beta, Anti-Protein N22.1, Anti-Tctex1 domain-containing protein 4 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
848,00 €
TCTEX1D4 PrEST Antigen
Artikelnummer: ATA-APrEST86150.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | TCTEX1D4, Tctex-2-beta, Protein N22.1, Dynein light chain Tctex-type 4, Tctex1 domain-containing protein 4 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-TC1D4
Artikelnummer: ELK-ES12782.100
Recommended dilutions: WB 1:500-2000. Cellular localization: Cell projection, cilium, flagellum . Cytoplasmic vesicle, secretory vesicle, acrosome . Cytoplasm, cytoskeleton, cilium axoneme . Cytoplasm . Nucleus . Cytoplasm, cytoskeleton, microtubule organizing center . Present along the entire length of the...
| Schlagworte: | Anti-TCTEX1D4, Anti-Tctex-2-beta, Anti-Protein N22.1, Anti-Dynein light chain Tctex-type 4, Anti-Tctex1 domain-containing... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
DYNLT4 PrEST Antigen
Artikelnummer: ATA-APrEST95685.100
PrEST Antigen DYNLT4, Gene description: dynein light chain Tctex-type 4, Alternative Gene Names: TCTEX1D4, Antigen sequence: LVRELCEQVHVRLRELSPPRYKLVCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYCE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 74% Rat gene...
| Schlagworte: | TCTEX1D4, Tctex-2-beta, Protein N22.1, Dynein light chain Tctex-type 4, Tctex1 domain-containing protein 4 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €