Zu "GeneID 2877" wurden 21 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-GPX2
Artikelnummer: ATA-HPA075070.100
Polyclonal Antibody against Human GPX2, Gene description: glutathione peroxidase 2, Alternative Gene Names: GSHPX-GI, Validated applications: ICC, Uniprot ID: P18283, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Could play a major role in protecting...
| Schlagworte: | Anti-GPX2, Anti-GPx-2, Anti-GPRP-2, Anti-GPx-GI, Anti-GSHPx-2, Anti-GSHPx-GI, EC=1.11.1.9, Anti-Glutathione peroxidase 2,... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
477,00 €
Anti-Glutathione peroxidase 2, Internal
Artikelnummer: ARG63800.100
Protein function: Could play a major role in protecting mammals from the toxicity of ingested organic hydroperoxides. Tert-butyl hydroperoxide, cumene hydroperoxide and linoleic acid hydroperoxide but not phosphatidycholine hydroperoxide, can act as acceptors. [The UniProt Consortium]
| Schlagworte: | Anti-GPX2, Anti-GPx-2, Anti-GPx-GI, Anti-GPRP-2, Anti-GSHPx-2, Anti-GSHPx-GI, EC=1.11.1.9, Anti-Glutathione peroxidase 2,... |
| Anwendung: | ELISA, WB |
| Wirt: | Goat |
| Spezies-Reaktivität: | human |
822,00 €
Human Glutathione Peroxidase 2 / GPX2 ELISA Kit
Artikelnummer: G-HUFI01311.96
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
641,00 €
Anti-Glutathione peroxidase 2
Artikelnummer: NSJ-R35954-100UG
0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: GPX2, GI-GPx, GSHPX-GI Protein function: Could play a major role in protecting mammals from the toxicity of ingested organic hydroperoxides. Tert-butyl hydroperoxide, cumene hydroperoxide and...
| Schlagworte: | Anti-GPX2, Anti-GPx-2, Anti-GPRP-2, Anti-GPx-GI, Anti-GSHPx-2, Anti-GSHPx-GI, EC=1.11.1.9, Anti-Glutathione peroxidase 2,... |
| Anwendung: | WB, ELISA (peptide) |
| Wirt: | Goat |
| Spezies-Reaktivität: | human |
790,00 €
Anti-GPX2
Artikelnummer: ARG59621.100
Protein function: Could play a major role in protecting mammals from the toxicity of ingested organic hydroperoxides. Tert-butyl hydroperoxide, cumene hydroperoxide and linoleic acid hydroperoxide but not phosphatidycholine hydroperoxide, can act as acceptors. [The UniProt Consortium]
| Schlagworte: | Anti-GPX2, Anti-GPx-2, Anti-GPx-GI, Anti-GPRP-2, Anti-GSHPx-2, Anti-GSHPx-GI, EC=1.11.1.9, Anti-Glutathione peroxidase 2,... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
658,00 €
Anti-GPX2
Artikelnummer: E-AB-66645.120
The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in...
| Schlagworte: | Anti-GPX2, Anti-GPx-2, Anti-GPRP-2, Anti-GPx-GI, Anti-GSHPx-2, Anti-GSHPx-GI, EC=1.11.1.9, Anti-Glutathione peroxidase 2,... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 243,00 €
Anti-GPX2
Artikelnummer: ATA-HPA003545.100
Protein function: Could play a major role in protecting mammals from the toxicity of ingested organic hydroperoxides. Tert-butyl hydroperoxide, cumene hydroperoxide and linoleic acid hydroperoxide but not phosphatidycholine hydroperoxide, can act as acceptors. [The UniProt Consortium] Buffer: 40% glycerol and PBS...
| Schlagworte: | Anti-GPX2, Anti-GPx-2, Anti-GPRP-2, Anti-GPx-GI, Anti-GSHPx-2, Anti-GSHPx-GI, EC=1.11.1.9, Anti-Glutathione peroxidase 2,... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 239,00 €
GPX2 (human, recombinant)
Artikelnummer: Cay39630-100
Glutathione peroxidase 2 (GPX2) is a selenocysteine-containing glutathione peroxidase that protects cells from oxidative damage. It is a homotetramer and has an active site containing selenocysteine, glutamine, asparagine, and tryptophan. mRNA encoding GPX2 has been found predominantly in the liver and...
| Schlagworte: | GPX2, GPx-2, GPx-GI, GPRP-2, GSHPx-2, GSHPx-GI, EC=1.11.1.9, Glutathione peroxidase 2, Glutathione... |
| Anwendung: | Active enzyme |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
ab 557,00 €
Human GPX2 (Glutathione Peroxidase 2, Gastrointestinal)...
Artikelnummer: ELK-ELK4705.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human GPX2. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human GPX2. Next,...
| Schlagworte: | GPx-2, GPx-GI, GPRP-2, GSHPx-2, GSHPx-GI, Glutathione peroxidase 2, Gastrointestinal glutathione peroxidase, Glutathione... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
ab 374,00 €
GPX2 (human), recombinant protein
Artikelnummer: ABS-PP-4014.100
| Schlagworte: | Glutathione peroxidase 2, GPx-2, GSHPx-2, Gastrointestinal glutathione peroxidase, Glutathione... |
| MW: | 23 kD |
ab 90,00 €
GPX2 PrEST Antigen
Artikelnummer: ATA-APrEST96064.100
PrEST Antigen GPX2, Gene description: glutathione peroxidase 2, Alternative Gene Names: GSHPX-GI, Antigen sequence: MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVAS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Could play a major role in protecting mammals from the toxicity of...
| Schlagworte: | GPX2, GPx-2, GPRP-2, GPx-GI, GSHPx-2, GSHPx-GI, EC=1.11.1.9, Glutathione peroxidase 2, Glutathione... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
265,00 €
Anti-GPX2, Biotin conjugated
Artikelnummer: CSB-PA009867LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: GPX2. Antigen Species: Human
| Schlagworte: | Anti-GPX2, Anti-GPx-2, Anti-GPRP-2, Anti-GPx-GI, Anti-GSHPx-2, Anti-GSHPx-GI, EC=1.11.1.9, Anti-Glutathione peroxidase 2,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €