Zu "GeneID 285282" wurden 11 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-RABL3
Artikelnummer: ARG59858.100
| Schlagworte: | Anti-RABL3, Anti-Rab-like protein 3 |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
707,00 €
Anti-RABL3
Artikelnummer: ATA-HPA035150.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Schlagworte: | Anti-RABL3, Anti-Rab-like protein 3 |
| Anwendung: | ICC, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Anti-RABL3
Artikelnummer: ATA-HPA035151.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Schlagworte: | Anti-RABL3, Anti-Rab-like protein 3 |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Anti-RABL3
Artikelnummer: ATA-HPA069861.100
Polyclonal Antibody against Human RABL3, Gene description: RAB, member of RAS oncogene family like 3, Alternative Gene Names: MGC23920, Validated applications: ICC, Uniprot ID: Q5HYI8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Required for KRAS...
| Schlagworte: | Anti-RABL3, Anti-Rab-like protein 3 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
RABL3 (human), recombinant protein
Artikelnummer: ABS-PP-9200-L.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Schlagworte: | Rab-like protein 3, Recombinant Human RABL3 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 18.5 kD |
ab 115,00 €
RABL3 PrEST Antigen
Artikelnummer: ATA-APrEST79393.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Schlagworte: | RABL3, Rab-like protein 3 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
RABL3 PrEST Antigen
Artikelnummer: ATA-APrEST79394.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Schlagworte: | RABL3, Rab-like protein 3 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Anti-RABL3
Artikelnummer: G-CAB14327.20
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Schlagworte: | Anti-RABL3, Anti-Rab-like protein 3 |
| Anwendung: | WB, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
103,00 €
Anti-RABL3
Artikelnummer: CSB-PA019239GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: RABL3. Antigen Species: Human
| Schlagworte: | Anti-RABL3, Anti-Rab-like protein 3, RAB member of RAS oncogene family like 3 antibody, Rab-like protein 3 antibody, RABL3... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
552,00 €
RABL3 (human), recombinant protein
Artikelnummer: ABS-PP-9200.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Schlagworte: | Rab-like protein 3, Recombinant Human RABL3 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 18.5 kD |
ab 90,00 €
RABL3 PrEST Antigen
Artikelnummer: ATA-APrEST95921.100
PrEST Antigen RABL3, Gene description: RAB, member of RAS oncogene family like 3, Alternative Gene Names: MGC23920, Antigen sequence: NKKSSQNLRRWSLEALNRDLVPTGVLVTNGDYDQEQFADNQIPLLVIGTKLDQIHETKRHEVLTRTAF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Required for KRAS...
| Schlagworte: | RABL3, Rab-like protein 3 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €