- Suchergebnis für GeneID 285282
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 285282" wurden 11 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ARG59858.100
| Schlagworte: | Anti-RABL3, Anti-Rab-like protein 3 |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
707,00 €
Artikelnummer: ATA-HPA035150.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Schlagworte: | Anti-RABL3, Anti-Rab-like protein 3 |
| Anwendung: | ICC, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Artikelnummer: ATA-HPA035151.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Schlagworte: | Anti-RABL3, Anti-Rab-like protein 3 |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: ATA-HPA069861.100
Polyclonal Antibody against Human RABL3, Gene description: RAB, member of RAS oncogene family like 3, Alternative Gene Names: MGC23920, Validated applications: ICC, Uniprot ID: Q5HYI8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Required for KRAS...
| Schlagworte: | Anti-RABL3, Anti-Rab-like protein 3 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ABS-PP-9200-L.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Schlagworte: | Rab-like protein 3, Recombinant Human RABL3 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 18.5 kD |
ab 115,00 €
Artikelnummer: ATA-APrEST79393.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Schlagworte: | RABL3, Rab-like protein 3 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ATA-APrEST79394.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Schlagworte: | RABL3, Rab-like protein 3 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: G-CAB14327.20
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Schlagworte: | Anti-RABL3, Anti-Rab-like protein 3 |
| Anwendung: | WB, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
103,00 €
Artikelnummer: CSB-PA019239GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: RABL3. Antigen Species: Human
| Schlagworte: | Anti-RABL3, Anti-Rab-like protein 3, RAB member of RAS oncogene family like 3 antibody, Rab-like protein 3 antibody, RABL3... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
552,00 €
Artikelnummer: ABS-PP-9200.100
Protein function: Required for KRAS signaling regulation and modulation of cell proliferation (PubMed:31406347). Regulator of KRAS prenylation, and probably prenylation of other small GTPases (PubMed:31406347). Required for lymphocyte development and function. Not required for myeloid cell development. [The UniProt...
| Schlagworte: | Rab-like protein 3, Recombinant Human RABL3 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 18.5 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95921.100
PrEST Antigen RABL3, Gene description: RAB, member of RAS oncogene family like 3, Alternative Gene Names: MGC23920, Antigen sequence: NKKSSQNLRRWSLEALNRDLVPTGVLVTNGDYDQEQFADNQIPLLVIGTKLDQIHETKRHEVLTRTAF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Required for KRAS...
| Schlagworte: | RABL3, Rab-like protein 3 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €