Zu "GeneID 27006" wurden 20 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Fibroblast Growth Factor-22
Fibroblast Growth Factor-22

Artikelnummer: 009-001-U78-0005

Fibroblast Growth Factor-22 purity was determined to be greater than 97% as determined by analysis by HpLC, UV-Spectroscopy at 280nm, and by reducing and non-reducing SDS-pAGE. Protein function: Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in...
Schlagworte: FGF22, FGF-22, Fibroblast growth factor 22
Anwendung: Cell culture
Exprimiert in: E.coli
Ursprungsart: human
186,00 €
Bewerten
Fibroblast Growth Factor-22
Fibroblast Growth Factor-22

Artikelnummer: 009-001-U78-0020

Fibroblast Growth Factor-22 purity was determined to be greater than 97% as determined by analysis by HpLC, UV-Spectroscopy at 280nm, and by reducing and non-reducing SDS-pAGE. Protein function: Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in...
Schlagworte: FGF22, FGF-22, Fibroblast growth factor 22
Anwendung: Cell culture
Exprimiert in: E.coli
Ursprungsart: human
445,00 €
Bewerten
Fibroblast Growth Factor-22
Fibroblast Growth Factor-22

Artikelnummer: 009-001-U78-0100

Fibroblast Growth Factor-22 purity was determined to be greater than 97% as determined by analysis by HpLC, UV-Spectroscopy at 280nm, and by reducing and non-reducing SDS-pAGE. Protein function: Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in...
Schlagworte: FGF22, FGF-22, Fibroblast growth factor 22
Anwendung: Cell culture
Exprimiert in: E.coli
Ursprungsart: human
1.466,00 €
Bewerten
Anti-FGF22
Anti-FGF22

Artikelnummer: NSJ-R30527

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Fibroblast growth factor 22, is a protein which in humans is encoded by the FGF22 gene. The FGF22 sequence in a genomic clone is assigned to 19p13.3. The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members...
Schlagworte: Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22, FGF22 Antibody
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
790,00 €
Bewerten
Human FGF22 recombinant protein (Active)
Human FGF22 recombinant protein (Active)

Artikelnummer: ARG70128.100

Protein function: Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in vitro). May be involved in hair development. [The UniProt Consortium]
Schlagworte: FGF22, FGF-22, Fibroblast growth factor 22
Anwendung: SDS-PAGE, Cell culture
Ursprungsart: human
ab 345,00 €
Bewerten
Fibroblast growth factor 22 (FGF22), human, recombinant
Fibroblast growth factor 22 (FGF22), human, recombinant

Artikelnummer: CSB-EP008628HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 23-170aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: TPSASRGPRS YPHLEGDVRW RRLFSSTHFF LRVDPGGRVQ GTRWRHGQDS ILEIRSVHVG VVVIKAVSSG FYVAMNRRGR LYGSRLYTVD CRFRERIEEN GHNTYASQRW...
Schlagworte: FGF22, FGF-22, Fibroblast growth factor 22, Recombinant Human Fibroblast growth factor 22 (FGF22)
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: human
MW: 30.1 kD
ab 247,00 €
Bewerten
Anti-FGF22
Anti-FGF22

Artikelnummer: CSB-PA002519.100

Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Schlagworte: Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22, FGF 22 antibody, FGF-22 antibody, FGF22 antibody, FGF22_HUMAN...
Anwendung: ELISA, WB, IHC, IF
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
ab 126,00 €
Bewerten
Anti-FGF22
Anti-FGF22

Artikelnummer: CSB-PA077924.100

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: FGF22. Antigen Species: Human
Schlagworte: Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22, FGF 22 antibody, FGF-22 antibody, FGF22 antibody, FGF22_HUMAN...
Anwendung: ELISA, IHC
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
ab 167,00 €
Bewerten
Human FGF22 (Fibroblast growth factor 22) ELISA Kit
Human FGF22 (Fibroblast growth factor 22) ELISA Kit

Artikelnummer: G-AEKE12235.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human FGF22. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human FGF22. Next,...
Schlagworte: FGF22, Fibroblast growth factor 22
Anwendung: ELISA
Spezies-Reaktivität: swine
801,00 €
Bewerten
Anti-FGF22, NT (FGF22, Fibroblast growth factor 22) (Azide Free) (Biotin)
Anti-FGF22, NT (FGF22, Fibroblast growth factor 22)...

Artikelnummer: 035623-Biotin.200

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and...
Schlagworte: Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
1.104,00 €
Bewerten
Anti-FGF22, NT (FGF22, Fibroblast growth factor 22)
Anti-FGF22, NT (FGF22, Fibroblast growth factor 22)

Artikelnummer: 035623.200

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and...
Schlagworte: Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
865,00 €
Bewerten
FGF-22 protein(N-His)(active) (recombinant human)
FGF-22 protein(N-His)(active) (recombinant human)

Artikelnummer: E-PKSH034161.100

Activity: Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <2 ng/mL. Sequence: MRRRLWLGLAWLLLARAPDAAGTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS. Fusion tag: N-His Endotoxin:...
Schlagworte: FGF22, FGF-22, Fibroblast growth factor 22, Recombinant Human FGF-22 protein(N-His)(active)
Anwendung: Active, cell culture
Exprimiert in: E.coli
Ursprungsart: human
MW: 20.49 kD
ab 241,00 €
Bewerten
1 von 2 Seiten