- Suchergebnis für GeneID 27006
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 27006" wurden 20 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: 009-001-U78-0005
Fibroblast Growth Factor-22 purity was determined to be greater than 97% as determined by analysis by HpLC, UV-Spectroscopy at 280nm, and by reducing and non-reducing SDS-pAGE. Protein function: Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in...
| Schlagworte: | FGF22, FGF-22, Fibroblast growth factor 22 |
| Anwendung: | Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
186,00 €
Artikelnummer: 009-001-U78-0020
Fibroblast Growth Factor-22 purity was determined to be greater than 97% as determined by analysis by HpLC, UV-Spectroscopy at 280nm, and by reducing and non-reducing SDS-pAGE. Protein function: Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in...
| Schlagworte: | FGF22, FGF-22, Fibroblast growth factor 22 |
| Anwendung: | Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
445,00 €
Artikelnummer: 009-001-U78-0100
Fibroblast Growth Factor-22 purity was determined to be greater than 97% as determined by analysis by HpLC, UV-Spectroscopy at 280nm, and by reducing and non-reducing SDS-pAGE. Protein function: Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in...
| Schlagworte: | FGF22, FGF-22, Fibroblast growth factor 22 |
| Anwendung: | Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
1.466,00 €
Artikelnummer: NSJ-R30527
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Fibroblast growth factor 22, is a protein which in humans is encoded by the FGF22 gene. The FGF22 sequence in a genomic clone is assigned to 19p13.3. The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members...
| Schlagworte: | Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22, FGF22 Antibody |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
790,00 €
Artikelnummer: ARG70128.100
Protein function: Plays a role in the fasting response, glucose homeostasis, lipolysis and lipogenesis. Can stimulate cell proliferation (in vitro). May be involved in hair development. [The UniProt Consortium]
| Schlagworte: | FGF22, FGF-22, Fibroblast growth factor 22 |
| Anwendung: | SDS-PAGE, Cell culture |
| Ursprungsart: | human |
ab 345,00 €
Artikelnummer: CSB-EP008628HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 23-170aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: TPSASRGPRS YPHLEGDVRW RRLFSSTHFF LRVDPGGRVQ GTRWRHGQDS ILEIRSVHVG VVVIKAVSSG FYVAMNRRGR LYGSRLYTVD CRFRERIEEN GHNTYASQRW...
| Schlagworte: | FGF22, FGF-22, Fibroblast growth factor 22, Recombinant Human Fibroblast growth factor 22 (FGF22) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 30.1 kD |
ab 247,00 €
Artikelnummer: CSB-PA002519.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22, FGF 22 antibody, FGF-22 antibody, FGF22 antibody, FGF22_HUMAN... |
| Anwendung: | ELISA, WB, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 126,00 €
Artikelnummer: CSB-PA077924.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: FGF22. Antigen Species: Human
| Schlagworte: | Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22, FGF 22 antibody, FGF-22 antibody, FGF22 antibody, FGF22_HUMAN... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 167,00 €
Artikelnummer: G-AEKE12235.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human FGF22. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human FGF22. Next,...
| Schlagworte: | FGF22, Fibroblast growth factor 22 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
801,00 €
Artikelnummer: 035623-Biotin.200
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and...
| Schlagworte: | Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
1.104,00 €
Artikelnummer: 035623.200
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and...
| Schlagworte: | Anti-FGF22, Anti-FGF-22, Anti-Fibroblast growth factor 22 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
865,00 €
Artikelnummer: E-PKSH034161.100
Activity: Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <2 ng/mL. Sequence: MRRRLWLGLAWLLLARAPDAAGTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS. Fusion tag: N-His Endotoxin:...
| Schlagworte: | FGF22, FGF-22, Fibroblast growth factor 22, Recombinant Human FGF-22 protein(N-His)(active) |
| Anwendung: | Active, cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 20.49 kD |
ab 241,00 €