Zu "GeneID 25946" wurden 8 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ZNF385A
Anti-ZNF385A

Artikelnummer: ATA-HPA076214.100

Polyclonal Antibody against Human ZNF385A, Gene description: zinc finger protein 385A, Alternative Gene Names: DKFZp586G1122, Hzf, ZFP385, ZNF385, Validated applications: ICC, WB, Uniprot ID: Q96PM9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
Schlagworte: Anti-HZF, Anti-ZNF385A, Anti-Zinc finger protein 385A, Anti-Retinal zinc finger protein, Anti-Hematopoietic zinc finger...
Anwendung: WB, ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
Anti-ZNF385A
Anti-ZNF385A

Artikelnummer: ATA-HPA076214.25

Polyclonal Antibody against Human ZNF385A, Gene description: zinc finger protein 385A, Alternative Gene Names: DKFZp586G1122, Hzf, ZFP385, ZNF385, Validated applications: ICC, WB, Uniprot ID: Q96PM9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
Schlagworte: Anti-HZF, Anti-ZNF385A, Anti-Zinc finger protein 385A, Anti-Retinal zinc finger protein, Anti-Hematopoietic zinc finger...
Anwendung: WB, ICC
Wirt: Rabbit
Spezies-Reaktivität: human
361,00 €
Bewerten
ZNF385, Human, Real Time PCR Primer Set
ZNF385, Human, Real Time PCR Primer Set

Artikelnummer: VHPS-10262

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: HZF, ZNF385A, Zinc finger protein 385A, Retinal zinc finger protein, Hematopoietic zinc finger protein
Anwendung: RNA quantification
45,00 €
Bewerten
Anti-ZNF385A, NT (ZNF385A, HZF, RZF, ZNF385, Zinc finger protein 385A, Hematopoietic zinc finger pro
Anti-ZNF385A, NT (ZNF385A, HZF, RZF, ZNF385, Zinc finger...

Artikelnummer: 044214.200

Zinc finger proteins, such as ZNF385A, are regulatory proteins that act as transcription factors, bind single- or double-stranded RNA, or interact with other proteins (Sharma et al., 2004 [PubMed 15527981]). Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot:...
Schlagworte: Anti-HZF, Anti-ZNF385A, Anti-Zinc finger protein 385A, Anti-Retinal zinc finger protein, Anti-Hematopoietic zinc finger...
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
865,00 €
Bewerten
ZNF385A (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC
ZNF385A (Vector Vector will be determined during the...

Artikelnummer: CSB-CL026710HU.10

Length: 1101 Sequence: atgcagcccc cactggacct caagcagatc ctgcccttcc cactcgagcc agcccctacc cttggcctct tcagcaacta cagcaccatg gaccctgtgc agaaggctgt gctctcccac acttttgggg gacccttgct caagaccaag cggcccgtca tttcctgtaa tatctgtcaa atccgcttca attctcagag ccaggctgag gcgcactaca aaggtaatcg ccacgcccga cgagtcaaag gcattgaggc...
Schlagworte: HZF, ZNF385A, Zinc finger protein 385A, Retinal zinc finger protein, Hematopoietic zinc finger protein
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
176,00 €
Bewerten
ZNF385A (human), recombinant protein
ZNF385A (human), recombinant protein

Artikelnummer: ABS-PP-9528.100

Protein function: RNA-binding protein that affects the localization and the translation of a subset of mRNA. May play a role in adipogenesis through binding to the 3'-UTR of CEBPA mRNA and regulation of its translation. Targets ITPR1 mRNA to dendrites in Purkinje cells, and may regulate its activity-dependent...
Schlagworte: Zinc finger protein 385A, Hematopoietic zinc finger protein, Retinal zinc finger protein, Recombinant Human ZNF385A Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 26 kD
ab 90,00 €
Bewerten
ZNF385A PrEST Antigen
ZNF385A PrEST Antigen

Artikelnummer: ATA-APrEST95774.100

PrEST Antigen ZNF385A, Gene description: zinc finger protein 385A, Alternative Gene Names: DKFZp586G1122, Hzf, ZFP385, ZNF385, Antigen sequence: PVSMENGLGPAPGSPEKQPGSPSPPSIPETGQGVTKGEGGTPAPASLPGGSKEEE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: RNA-binding protein...
Schlagworte: HZF, ZNF385A, Zinc finger protein 385A, Retinal zinc finger protein, Hematopoietic zinc finger protein
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
ZNF385A (human), recombinant protein
ZNF385A (human), recombinant protein

Artikelnummer: ABS-PP-9528-L.100

Protein function: RNA-binding protein that affects the localization and the translation of a subset of mRNA. May play a role in adipogenesis through binding to the 3'-UTR of CEBPA mRNA and regulation of its translation. Targets ITPR1 mRNA to dendrites in Purkinje cells, and may regulate its activity-dependent...
Schlagworte: Zinc finger protein 385A, Hematopoietic zinc finger protein, Retinal zinc finger protein, Recombinant Human ZNF385A Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 26 kD
ab 115,00 €
Bewerten