Zu "GeneID 256471" wurden 11 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-MFSD8
Anti-MFSD8

Artikelnummer: ATA-HPA044802.100

Protein function: May be a carrier that transport small solutes by using chemiosmotic ion gradients. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 66% and to rat: 66%
Schlagworte: Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing...
Anwendung: IHC, WB
Wirt: Rabbit
Spezies-Reaktivität: human
ab 330,00 €
Bewerten
Anti-MFSD8
Anti-MFSD8

Artikelnummer: G-PACO39166.50

MFSD8 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. MFSD8 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May be a carrier that transport small solutes by using chemiosmotic ion gradients. [The...
Schlagworte: Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing...
Anwendung: ELISA, IHC, IF
Wirt: Rabbit
Spezies-Reaktivität: human
313,00 €
Bewerten
Major facilitator superfamily domain-containing protein 8 (MFSD8), partial, human, recombinant
Major facilitator superfamily domain-containing protein 8...

Artikelnummer: CSB-EP844087HU1.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-40aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-GST-tagged. Target Protein Sequence: MAGLRNESEQ EPLLGDTPGS REWDILETEE HYKSRWRSIR. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test. Biological Activity: n/a. Form:...
Schlagworte: CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8,...
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: human
MW: 34.8 kD
ab 292,00 €
Bewerten
MFSD8, Recombinant, Human, aa1-40, His-GST-Tag (Major Facilitator Superfamily Domain-containing Prot
MFSD8, Recombinant, Human, aa1-40, His-GST-Tag (Major...

Artikelnummer: 374200.100

May be a carrier that transport small solutes by using chemiosmotic ion gradients. Source: Recombinant protein corresponding to aa1-40 from human MFSD8, fused to His-GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~34.8kD, AA Sequence: MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIR, Storage and Stability:...
Schlagworte: CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8
MW: 34,8
ab 690,00 €
Bewerten
MFSD8 PrEST Antigen
MFSD8 PrEST Antigen

Artikelnummer: ATA-APrEST84093.100

Protein function: May be a carrier that transport small solutes by using chemiosmotic ion gradients. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten
Anti-MFSD8
Anti-MFSD8

Artikelnummer: ELK-ES11413.100

This gene encodes a ubiquitous integral membrane protein that contains a transporter domain and a major facilitator superfamily (MFS) domain. Other members of the major facilitator superfamily transport small solutes through chemiosmotic ion gradients. The substrate transported by this protein is unknown. The...
Schlagworte: Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing protein 8, MFSD8...
Anwendung: WB, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human, rat, mouse,
ab 173,00 €
Bewerten
MFSD8 (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC,
MFSD8 (Vector Vector will be determined during the...

Artikelnummer: CSB-CL844087HU.10

Length: 1557 Sequence: atggccggcc tgcggaacga aagtgaacag gagccgctct taggcgacac acctggaagc agagaatggg acattttaga gactgaagag cattataaga gccgatggag atctattagg attttatatc ttactatgtt tctcagcagt gtagggtttt ctgtagtgat gatgtccata tggccatatc tccaaaagat tgatccgaca gctgatacaa gttttttggg ctgggttatt gcttcatata gtcttggcca...
Schlagworte: CLN7, MFSD8, Ceroid-lipofuscinosis neuronal protein 7, Major facilitator superfamily domain-containing protein 8
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
357,00 €
Bewerten
Anti-MFSD8
Anti-MFSD8

Artikelnummer: CSB-PA844087LA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
Schlagworte: Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing...
Anwendung: ELISA, IHC, IF
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-MFSD8, HRP conjugated
Anti-MFSD8, HRP conjugated

Artikelnummer: CSB-PA844087LB01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
Schlagworte: Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-MFSD8, FITC conjugated
Anti-MFSD8, FITC conjugated

Artikelnummer: CSB-PA844087LC01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
Schlagworte: Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing...
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-MFSD8, Biotin conjugated
Anti-MFSD8, Biotin conjugated

Artikelnummer: CSB-PA844087LD01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MFSD8. Antigen Species: Human
Schlagworte: Anti-CLN7, Anti-MFSD8, Anti-Ceroid-lipofuscinosis neuronal protein 7, Anti-Major facilitator superfamily domain-containing...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten