Zu "GeneID 25295" wurden 21 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-Osteocalcin
Artikelnummer: NSJ-R32433
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Osteocalcin, also known as bone gamma-carboxyglutamic acid-containing protein (BGLAP), is a noncollagenous protein found in bone and dentin. In humans, the osteocalcin is encoded by the BGLAP gene. Its receptor is GPRC6A. It is mapped to 1q22. Osteocalcin may...
| Schlagworte: | Anti-BGP, Anti-Bglap, Anti-Bglap2, Anti-Osteocalcin, Anti-Bone Gla protein, Anti-Gamma-carboxyglutamic acid-containing... |
| Anwendung: | IHC (paraffin), FC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | rat |
790,00 €
Rat OC/BGP (Osteocalcin) CLIA Kit
Artikelnummer: E-CL-R0169.96
Type: Sandwich. Detection Range: 0.16~10ng/mL. Sensitivity: 0.09ng/mL. Tested Sample Types: Serum, Plasma, Cell supernatant. Test principle: This CLIA kit uses the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Rat OC/BGP . Standards or samples...
| Schlagworte: | BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| Anwendung: | CLIA |
| Spezies-Reaktivität: | rat |
553,00 €
Anti-Osteocalcin
Artikelnummer: ARG59341.50
Protein function: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. [The UniProt Consortium]
| Schlagworte: | Anti-BGP, Anti-Bglap, Anti-Bglap2, Anti-Osteocalcin, Anti-Bone Gla protein, Anti-Gamma-carboxyglutamic acid-containing... |
| Anwendung: | FC, IHC (paraffin) |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | rat |
551,00 €
Rat OC (Osteocalcin) ELISA Kit
Artikelnummer: ELK-ELK2391.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat OC. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat OC. Next, Avidin...
| Schlagworte: | BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 374,00 €
Osteocalcin (Bglap), rat, recombinant
Artikelnummer: CSB-EP002682RA.1
Organism: Rattus norvegicus (Rat). Source: E.coli. Expression Region: 50-99aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal GST-tagged. Target Protein Sequence: YLNNGLGAPA PYPDPLEPHR EVCELNPNCD ELADHIGFQD AYKRIYGTTV. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test....
| Schlagworte: | BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, Recombinant Rat... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | rat |
| MW: | 32.6 kD |
ab 292,00 €
Osteocalcin Protein, Rat, Recombinant (GST)
Artikelnummer: TGM-TMPH-03346-100ug
Description: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Osteocalcin Protein, Rat, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 32.6 kDa and the accession number is P04640.
| Schlagworte: | Gamma-carboxyglutamic acid-containing protein, Bglap, Osteocalcin, Bone Gla protein |
| MW: | 32.6 kD |
ab 266,00 €
Recombinant Rat OC/BGP protein(His&SUMO tag)
Artikelnummer: E-PDER100164.1
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
| Schlagworte: | Bglap, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, Recombinant Rat OC/BGP... |
| Exprimiert in: | E.coli |
| Ursprungsart: | rat |
ab 192,00 €
NEU
Rat OC (Osteocalcin) ELISA Kit
Artikelnummer: G-AEKE06645.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat OC. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat OC. Next, Avidin...
| Schlagworte: | Bglap, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
694,00 €
Osteocalcin, Recombinant, Rat, aa50-99, GST-Tag (Bglap)
Artikelnummer: 370728.100
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. Source: Recombinant protein corresponding to aa50-99 from rat Bglap, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33kD, AA Sequence: YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV, Storage and...
| Schlagworte: | BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| MW: | 33 |
ab 690,00 €
Rat OC/BGP (Osteocalcin) ELISA Kit
Artikelnummer: E-EL-R3070.24
Type: Sandwich-ELISA. Detection Range: 31.25-2000 pg/mL. Sensitivity: 45.49 pg/mL. Tested Sample Types: Serum, plasma and other biological fluids. Test principle: This ELISA kit uses the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to OC/BGP ....
| Schlagworte: | BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 122,00 €
Rat Osteocalcin/Bone gla protein, OT/BGP ELISA kit
Artikelnummer: CSB-E05129r.48
Sample Types: serum, plasma, tissue homogenates. Detection Range: 125 pg/mL- 8000 pg/mL Sensitivity: 31.25 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Constitutes 1-2% of the total bone protein. It binds strongly to...
| Schlagworte: | BGP, Bglap, Bglap2, Osteocalcin, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein |
| Anwendung: | ELISA, Sandwich ELISA |
| Spezies-Reaktivität: | rat |
ab 711,00 €
Anti-Bglap
Artikelnummer: G-PACO25252.50
Bglap Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Rat and for use in ELISA applications. Bglap Antibody is a high quality polyclonal antibody for research use only.. Protein function: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium. [The UniProt...
| Schlagworte: | Anti-BGP, Anti-Bglap, Anti-Bglap2, Anti-Osteocalcin, Anti-Bone Gla protein, Anti-Gamma-carboxyglutamic acid-containing... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Rat |
313,00 €