- Suchergebnis für GeneID 24694
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 24694" wurden 12 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ARG82254.96
Protein function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2- deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells. [The UniProt Consortium]
| Schlagworte: | Pth, PTH, Parathyrin, Parathyroid hormone |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
1.850,00 €
Artikelnummer: E-PDER100113.1
PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
| Schlagworte: | Pth, Parathyrin, Parathyroid hormone, Recombinant Rat I-PTH Protein(Trx Tag) |
ab 192,00 €
Artikelnummer: E-PDER100658.1
Protein function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D- glucose (2DG) transport and glycogen synthesis in osteoblastic cells. [The UniProt Consortium]
| Schlagworte: | PTH, Pth, Parathyrin, Parathyroid hormone, Recombinant Rat I-PTH Protein(Trx Tag) |
| Exprimiert in: | E.coli |
| Ursprungsart: | rat |
ab 192,00 €
Artikelnummer: CSB-E07866r.48
Sample Types: serum, plasma, tissue homogenates Detection Range: 6.25 pg/mL-400 pg/mL Sensitivity: 1.56 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: PTH elevates calcium level by dissolving the salts in bone and...
| Schlagworte: | Pth, PTH, Parathyrin, Parathyroid hormone |
| Anwendung: | ELISA, Sandwich ELISA |
| Spezies-Reaktivität: | rat |
ab 711,00 €
Artikelnummer: 000-001-M31
Greater than 95% specific peptide. Parathyroid hormone (pTH) is the most important endocrine regulator of Ca2+ and phosphorus concentration in the extracellular fluid. pTH is secreted from cells of the parathyroid glands and acts for the most part via the binding to specific G-protein coupled receptors on the...
| Schlagworte: | Pth, PTH, Parathyrin, Parathyroid hormone |
634,00 €
Artikelnummer: 000-001-M32
Greater than 95% specific peptide. Parathyroid hormone (pTH) is the most important endocrine regulator of Ca2+ and phosphorus concentration in the extracellular fluid. pTH is secreted from cells of the parathyroid glands and acts for the most part via the binding to specific G-protein coupled receptors on the...
| Schlagworte: | Pth, PTH, Parathyrin, Parathyroid hormone |
472,00 €
Artikelnummer: VRPS-4911
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | PTH, Pth, Parathyrin, Parathyroid hormone |
| Anwendung: | RNA quantification |
54,00 €
Artikelnummer: 298235.1
PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells (By similarity). Source: Synthetic rat PTH , AA Sequence: AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF, Storage and Stability:...
| Schlagworte: | Pth, PTH, Parathyrin, Parathyroid hormone |
| Ursprungsart: | rat |
ab 477,00 €
Artikelnummer: G-AEES00445.96
ELISA Type: Sandwich. Detection Range: 15.63-1000µg/mL. Sensitivity: 9.38µg/mL. Sample Types: Serum, plasma and other biological fluids. Protein function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D- glucose (2DG) transport and...
| Schlagworte: | PTH, Pth, Parathyrin, Parathyroid hormone |
| Anwendung: | Sandwich |
| Spezies-Reaktivität: | rat |
708,00 €
Artikelnummer: CSB-PA018987ZA01RA.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-PTH, Anti-Pth, Anti-Parathyrin, Anti-Parathyroid hormone, Pth Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Rattus norvegicus (Rat) |
ab 1.529,00 €
Artikelnummer: G-RPES8228.20
Endotoxin level: < 10 EU/mg of the protein as determined by the LAL method. Protein function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D- glucose (2DG) transport and glycogen synthesis in osteoblastic cells. [The UniProt Consortium]
| Schlagworte: | Pth, PTH, Parathyrin, Parathyroid hormone |
| Exprimiert in: | E.coli |
| Ursprungsart: | rat |
306,00 €