Zu "GeneID 245937" wurden 12 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
NEU
Human DEFb124 (Defensin Beta 124) Microsample ELISA Kit
Artikelnummer: ELK-ELK6684MS.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human DEFb124. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human DEFb124....
| Schlagworte: | DEFB124, Beta-defensin 24, Beta-defensin 124, Defensin, beta 124 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
ab 374,00 €
DEFB124 Protein, Human, Recombinant (His)
Artikelnummer: TGM-TMPH-03815-100ug
Description: DEFB124 Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast) with N-6xHis. The accession number is Q8NES8.
| Schlagworte: | Beta-defensin 24 (DEFB-24) , DEFB24 , Beta-defensin 124 , Defensin, beta 124 , DEFB124 |
| MW: | 7.7 kD |
ab 80,00 €
Anti-DEFB124
Artikelnummer: ATA-HPA051046.100
Protein function: Has antibacterial activity. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 69% and to rat: 69%
| Schlagworte: | Anti-DEFB24, Anti-DEFB124, Anti-DEFB-24, Anti-Beta-defensin 24, Anti-Beta-defensin 124, Anti-Defensin, beta 124 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Human DEFb124 (Defensin Beta 124) ELISA Kit
Artikelnummer: ELK-ELK6684.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human DEFb124. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human DEFb124....
| Schlagworte: | DEFB24, DEFB-24, DEFB124, Beta-defensin 24, Beta-defensin 124, Defensin, beta 124 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
ab 374,00 €
Beta-defensin 124 (DEFB124), human, recombinant
Artikelnummer: CSB-YP836731HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 23-71aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: EFKRCWKGQG ACQTYCTRQE TYMHLCPDAS LCCLSYALKP PPVPKHEYE. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test....
| Schlagworte: | DEFB24, DEFB-24, DEFB124, Beta-defensin 24, Beta-defensin 124, Defensin, beta 124, Recombinant Human Beta-defensin 124... |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | human |
| MW: | 7.7 kD |
ab 242,00 €
Beta-defensin 124 (DEFB124), human, recombinant
Artikelnummer: CSB-EP836731HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 23-71aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: EFKRCWKGQG ACQTYCTRQE TYMHLCPDAS LCCLSYALKP PPVPKHEYE. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test....
| Schlagworte: | DEFB24, DEFB-24, DEFB124, Beta-defensin 24, Beta-defensin 124, Defensin, beta 124, Recombinant Human Beta-defensin 124... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 21.7 kD |
ab 219,00 €
Human DEFb124 (Defensin Beta 124) ELISA (Small Sample...
Artikelnummer: G-AEKE09992.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human DEFb124. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human DEFb124....
| Schlagworte: | DEFB124, Beta-defensin 24, Beta-defensin 124, Defensin, beta 124 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
694,00 €
Anti-DEFB124
Artikelnummer: CSB-PA836731ZA01HU.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-DEFB24, Anti-DEFB124, Anti-DEFB-24, Anti-Beta-defensin 24, Anti-Beta-defensin 124, Anti-Defensin, beta 124, DEFB124... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Homo sapiens (Human) |
ab 1.529,00 €
Defensin Beta 124 (DEFb124) BioAssay(TM) ELISA Kit (Human)
Artikelnummer: 152486.96
Defensin Beta 124 (DEFb124) BioAssay(TM) ELISA Kit (Human) is a Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Defensin Beta 124 (DEFb124). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated...
| Schlagworte: | DEFB24, DEFB124, DEFB-24, Beta-defensin 24, Beta-defensin 124, Defensin, beta 124 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
1.192,00 €
DEFB124, Recombinant, Human, aa23-71, His-SUMO-Tag...
Artikelnummer: 373026.1
Has antibacterial activity. Curated. Source: Recombinant protein corresponding to aa23-71 from human DEFB124, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~21.7kD, AA Sequence: EFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE, Storage and Stability: May be stored at 4°C for...
| Schlagworte: | DEFB24, DEFB124, DEFB-24, Beta-defensin 24, Beta-defensin 124, Defensin, beta 124 |
| MW: | 21,7 |
ab 603,00 €
DEFB124 PrEST Antigen
Artikelnummer: ATA-APrEST83157.100
Protein function: Has antibacterial activity. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | DEFB24, DEFB124, DEFB-24, Beta-defensin 24, Beta-defensin 124, Defensin, beta 124 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
DEFB124, Recombinant, Human, aa23-71, His-Tag...
Artikelnummer: 373027.100
Has antibacterial activity. Curated. Source: Recombinant protein corresponding to aa23-71 from human DEFB124, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~7.7kD, AA Sequence: EFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE, Storage and Stability: May be stored at 4°C for short-term only....
| Schlagworte: | DEFB24, DEFB124, DEFB-24, Beta-defensin 24, Beta-defensin 124, Defensin, beta 124 |
| MW: | 7,7 |
ab 557,00 €