- Suchergebnis für GeneID 23101
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 23101" wurden 12 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA038946.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 30% and to rat: 29%
| Schlagworte: | Anti-DRG, Anti-MCF2L2, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange factor... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 369,00 €
Artikelnummer: ATA-HPA038947.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 28% and to rat: 28%
| Schlagworte: | Anti-DRG, Anti-MCF2L2, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange factor... |
| Anwendung: | ICC, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 246,00 €
Artikelnummer: ABS-KC-2717.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Schlagworte: | Anti-Probable guanine nucleotide exchange factor MCF2L2, Anti-Dbs-related Rho family guanine nucleotide exchange factor,... |
| Anwendung: | IHC |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €
Artikelnummer: ABS-KC-2724.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Schlagworte: | Anti-Probable guanine nucleotide exchange factor MCF2L2, Anti-Dbs-related Rho family guanine nucleotide exchange factor,... |
| Anwendung: | IHC |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €
Artikelnummer: ATA-HPA061485.100
Polyclonal Antibody against Human MCF2L2, Gene description: MCF.2 cell line derived transforming sequence-like 2, Alternative Gene Names: ARHGEF22, KIAA0861, Validated applications: ICC, Uniprot ID: Q86YR7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Schlagworte: | Anti-DRG, Anti-MCF2L2, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange factor... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
Artikelnummer: ATA-HPA061485.25
Polyclonal Antibody against Human MCF2L2, Gene description: MCF.2 cell line derived transforming sequence-like 2, Alternative Gene Names: ARHGEF22, KIAA0861, Validated applications: ICC, Uniprot ID: Q86YR7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Schlagworte: | Anti-DRG, Anti-MCF2L2, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange factor... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: ATA-APrEST79286.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | DRG, MCF2L2, MCF2-transforming sequence-like protein 2, Probable guanine nucleotide exchange factor MCF2L2, Dbs-related... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ATA-APrEST79287.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | DRG, MCF2L2, MCF2-transforming sequence-like protein 2, Probable guanine nucleotide exchange factor MCF2L2, Dbs-related... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ABS-PP-9046.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Schlagworte: | Probable guanine nucleotide exchange factor MCF2L2, Dbs-related Rho family guanine nucleotide exchange factor,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 58.5 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95865.100
PrEST Antigen MCF2L2, Gene description: MCF.2 cell line derived transforming sequence-like 2, Alternative Gene Names: ARHGEF22, KIAA0861, Antigen sequence: MLSTEDLLMSHTRQRDKLQDELKLLGKQGTTLLSCIQEPATKCPNSKLNLNQLENVTTMERLLVQLDETEKAFSHFWSEHHLKLNQCLQLQHFEHDF, Storage: Upon delivery store at -20°C. Avoid repeated...
| Schlagworte: | DRG, MCF2L2, MCF2-transforming sequence-like protein 2, Probable guanine nucleotide exchange factor MCF2L2, Dbs-related... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €
Artikelnummer: ABS-KC-17179.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Schlagworte: | Anti-DRG, Anti-MCF2L2, Anti-MCF2-transforming sequence-like protein 2, Anti-Probable guanine nucleotide exchange factor... |
| Anwendung: | IHC |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 206,00 €
Artikelnummer: ABS-PP-9046-L.100
Protein function: Probably functions as a guanine nucleotide exchange factor. [The UniProt Consortium]
| Schlagworte: | Probable guanine nucleotide exchange factor MCF2L2, Dbs-related Rho family guanine nucleotide exchange factor,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 58.5 kD |
ab 115,00 €