Zu "GeneID 227526" wurden 12 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Mouse CDNF ELISA Kit
Mouse CDNF ELISA Kit

Artikelnummer: ARG81994.96

Protein function: Trophic factor for dopamine neurons. Prevents the 6- hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra. [The UniProt Consortium]
Schlagworte: Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor
Anwendung: ELISA
Spezies-Reaktivität: mouse
1.118,00 €
Bewerten
Cerebral Dopamine Neurotrophic Factor, mouse recombinant (rmCDNF)
Cerebral Dopamine Neurotrophic Factor, mouse recombinant...

Artikelnummer: 97638.1

CDNF mouse recombinant produced in E. coli is a single, non-glycosylated polypeptide chain containing 163 amino acids and having a molecular mass of 18.5 kDa. CDNF is a member of the ARMET family and acts as a trophic factor for dopamine neurons. CDNF inhibits the 6-hydroxydopamine (6-OHDA)-induced degeneration of...
Schlagworte: Cerebral dopamine neurotrophic factor, arginine-rich, mutated in early stage tumors-like 1, Conserved dopamine...
Anwendung: Cell culture
Exprimiert in: E.coli
Ursprungsart: mouse
MW: 18500 D
ab 105,00 €
Bewerten
CDNF Protein, Mouse, Recombinant (His)
CDNF Protein, Mouse, Recombinant (His)

Artikelnummer: TGM-TMPY-01916-100ug

Description: CDNF Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 20 kDa and the accession number is Q8CC36.
Schlagworte: cerebral dopamine neurotrophic factor, Armetl1, 9330140G23
MW: 20 kD
ab 505,00 €
Bewerten
Mouse CDNF (Cerebral Dopamine Neurotrophic Factor) ELISA Kit
Mouse CDNF (Cerebral Dopamine Neurotrophic Factor) ELISA Kit

Artikelnummer: G-AEKE11959.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse CDNF. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse CDNF. Next,...
Schlagworte: Cdnf, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor
Anwendung: ELISA
Spezies-Reaktivität: mouse
694,00 €
Bewerten
CDNF Protein, Mouse, Recombinant (His)
CDNF Protein, Mouse, Recombinant (His)

Artikelnummer: TGM-TMPY-01916-10ug

Description: CDNF Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 20 kDa and the accession number is Q8CC36.
Schlagworte: 9330140G23 , Armetl1 , cerebral dopamine neurotrophic factor
MW: 20 kD
ab 52,00 €
Bewerten
Anti-CDNF (Cerebral Dopamine Neurotrophic Factor, ARMET-like Protein 1, Conserved Dopamine Neurotrop
Anti-CDNF (Cerebral Dopamine Neurotrophic Factor,...

Artikelnummer: C2795-50B.100

CDNF, also called Armetl1, is a 17-19kD secreted protein that shares 52% aa identity with mouse MANF also called Armet. The Armet designation is not preferred, because the proteins as translated are not actually arginine-rich. However, both CDNF and MANF have a high proportion of charged residues, a pattern of eight...
Schlagworte: Anti-Cdnf, Anti-Armetl1, Anti-ARMET-like protein 1, Anti-Cerebral dopamine neurotrophic factor, Anti-Conserved dopamine...
Anwendung: IHC
Wirt: Rat
Spezies-Reaktivität: mouse
929,00 €
Bewerten
CDNF protein(N-His) (recombinant mouse)
CDNF protein(N-His) (recombinant mouse)

Artikelnummer: E-PKSM041510.100

Sequence: MRCISPTALVTFCAGFCISNPVLAQGLEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function:...
Schlagworte: Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor,...
Exprimiert in: E.coli
Ursprungsart: mouse
MW: 21.86 kD
ab 241,00 €
Bewerten
Recombinant Mouse CDNF / ARMETL1 Protein (His tag)
Recombinant Mouse CDNF / ARMETL1 Protein (His tag)

Artikelnummer: E-PKSM040608.100

Protein function: Trophic factor for dopamine neurons. Prevents the 6- hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra. [The UniProt Consortium]
Ursprungsart: mouse
632,00 €
Bewerten
Mouse CDNF (Cerebral Dopamine Neurotrophic Factor) ELISA Kit
Mouse CDNF (Cerebral Dopamine Neurotrophic Factor) ELISA Kit

Artikelnummer: ELK-ELK9415.48

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse CDNF. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse CDNF. Next,...
Schlagworte: Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor
Anwendung: ELISA
Spezies-Reaktivität: mouse
ab 374,00 €
Bewerten
Mouse Cdnf (Cerebral dopamine neurotrophic factor) ELISA Kit
Mouse Cdnf (Cerebral dopamine neurotrophic factor) ELISA Kit

Artikelnummer: G-AEFI00583.96

ELISA Type: Sandwich ELISA, Double Antibody. Detection Range: 15.625-1000µg/mL. Sensitivity: 9.375µg/mL. Sample Types: Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples. Protein function: Trophic factor for dopamine neurons. Prevents the 6- hydroxydopamine (6-OHDA)-induced...
Schlagworte: Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor
Anwendung: Sandwich ELISA, Double Antibody
Spezies-Reaktivität: mouse
698,00 €
Bewerten
Mouse CDNF Recombinant Protein (N-His)
Mouse CDNF Recombinant Protein (N-His)

Artikelnummer: G-RPES6733.20

Protein function: Trophic factor for dopamine neurons. Prevents the 6- hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra. [The UniProt Consortium]
Schlagworte: Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor
Exprimiert in: E.coli
Ursprungsart: mouse
384,00 €
Bewerten
Recombinant Mouse CDNF/ARMETL1 Protein (His Tag) (RPES1167)
Recombinant Mouse CDNF/ARMETL1 Protein (His Tag) (RPES1167)

Artikelnummer: G-RPES1167.100

Mouse CDNF/ARMETL1 Recombinant Protein (RPES1167) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Trophic factor for dopamine neurons. Prevents the 6- hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after...
Schlagworte: Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor
Exprimiert in: Human cells
Ursprungsart: mouse
1.006,00 €
Bewerten