- Suchergebnis für GeneID 227526
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 227526" wurden 12 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ARG81994.96
Protein function: Trophic factor for dopamine neurons. Prevents the 6- hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra. [The UniProt Consortium]
| Schlagworte: | Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
1.118,00 €
Artikelnummer: 97638.1
CDNF mouse recombinant produced in E. coli is a single, non-glycosylated polypeptide chain containing 163 amino acids and having a molecular mass of 18.5 kDa. CDNF is a member of the ARMET family and acts as a trophic factor for dopamine neurons. CDNF inhibits the 6-hydroxydopamine (6-OHDA)-induced degeneration of...
| Schlagworte: | Cerebral dopamine neurotrophic factor, arginine-rich, mutated in early stage tumors-like 1, Conserved dopamine... |
| Anwendung: | Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 18500 D |
ab 105,00 €
Artikelnummer: TGM-TMPY-01916-100ug
Description: CDNF Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 20 kDa and the accession number is Q8CC36.
| Schlagworte: | cerebral dopamine neurotrophic factor, Armetl1, 9330140G23 |
| MW: | 20 kD |
ab 505,00 €
Artikelnummer: G-AEKE11959.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse CDNF. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse CDNF. Next,...
| Schlagworte: | Cdnf, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
694,00 €
Artikelnummer: TGM-TMPY-01916-10ug
Description: CDNF Protein, Mouse, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 20 kDa and the accession number is Q8CC36.
| Schlagworte: | 9330140G23 , Armetl1 , cerebral dopamine neurotrophic factor |
| MW: | 20 kD |
ab 52,00 €
Artikelnummer: C2795-50B.100
CDNF, also called Armetl1, is a 17-19kD secreted protein that shares 52% aa identity with mouse MANF also called Armet. The Armet designation is not preferred, because the proteins as translated are not actually arginine-rich. However, both CDNF and MANF have a high proportion of charged residues, a pattern of eight...
| Schlagworte: | Anti-Cdnf, Anti-Armetl1, Anti-ARMET-like protein 1, Anti-Cerebral dopamine neurotrophic factor, Anti-Conserved dopamine... |
| Anwendung: | IHC |
| Wirt: | Rat |
| Spezies-Reaktivität: | mouse |
929,00 €
Artikelnummer: E-PKSM041510.100
Sequence: MRCISPTALVTFCAGFCISNPVLAQGLEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function:...
| Schlagworte: | Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 21.86 kD |
ab 241,00 €
Artikelnummer: E-PKSM040608.100
Protein function: Trophic factor for dopamine neurons. Prevents the 6- hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra. [The UniProt Consortium]
| Ursprungsart: | mouse |
632,00 €
Artikelnummer: ELK-ELK9415.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse CDNF. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse CDNF. Next,...
| Schlagworte: | Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
ab 374,00 €
Artikelnummer: G-AEFI00583.96
ELISA Type: Sandwich ELISA, Double Antibody. Detection Range: 15.625-1000µg/mL. Sensitivity: 9.375µg/mL. Sample Types: Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples. Protein function: Trophic factor for dopamine neurons. Prevents the 6- hydroxydopamine (6-OHDA)-induced...
| Schlagworte: | Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor |
| Anwendung: | Sandwich ELISA, Double Antibody |
| Spezies-Reaktivität: | mouse |
698,00 €
Artikelnummer: G-RPES6733.20
Protein function: Trophic factor for dopamine neurons. Prevents the 6- hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after 6-OHDA-lesioning, restores the dopaminergic function and prevents the degeneration of dopaminergic neurons in substantia nigra. [The UniProt Consortium]
| Schlagworte: | Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
384,00 €
Artikelnummer: G-RPES1167.100
Mouse CDNF/ARMETL1 Recombinant Protein (RPES1167) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Trophic factor for dopamine neurons. Prevents the 6- hydroxydopamine (6-OHDA)-induced degeneration of dopaminergic neurons. When administered after...
| Schlagworte: | Cdnf, Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor |
| Exprimiert in: | Human cells |
| Ursprungsart: | mouse |
1.006,00 €