Zu "GeneID 222698" wurden 11 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-NKAPL
Anti-NKAPL

Artikelnummer: G-PACO63099.50

NKAPL Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, WB applications. NKAPL Antibody is a high quality polyclonal antibody for research use only.. Protein function: Transcriptional repressor of Notch-mediated signaling. Required for spermatogenesis. [The...
Schlagworte: Anti-NKAPL, Anti-C6orf194, Anti-NKAP-like protein
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
313,00 €
Bewerten
Anti-NKAPL
Anti-NKAPL

Artikelnummer: ATA-HPA071697.100

Polyclonal Antibody against Human NKAPL, Gene description: NFKB activating protein like, Alternative Gene Names: bA424I5.1, C6orf194, Validated applications: ICC, Uniprot ID: Q5M9Q1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Transcriptional repressor...
Schlagworte: Anti-NKAPL, Anti-C6orf194, Anti-NKAP-like protein
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
491,00 €
Bewerten
NKAPL (human), recombinant protein
NKAPL (human), recombinant protein

Artikelnummer: ABS-PP-12185-L.100

Protein function: Transcriptional repressor of Notch-mediated signaling. Required for spermatogenesis. [The UniProt Consortium]
Schlagworte: NKAP-like protein, Recombinant Human NKAPL Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 17.5 kD
ab 115,00 €
Bewerten
Anti-NKAPL, CT (NKAPL, C6orf194, NKAP-like protein)
Anti-NKAPL, CT (NKAPL, C6orf194, NKAP-like protein)

Artikelnummer: 038986.200

The function of NKAPL remains unknown. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12...
Schlagworte: Anti-NKAPL, Anti-C6orf194, Anti-NKAP-like protein
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
865,00 €
Bewerten
NKAPL (Vector pUC, Accession No. BC038240)
NKAPL (Vector pUC, Accession No. BC038240)

Artikelnummer: CSB-CL702797HU.10

Length: 1209 Sequence: atgcccccag tatcccggtc cagctattcc gaggacatcg tgggctctcg gagaaggcga cgcagctcct cggggagccc accatccccg cagagcagat gttcctcttg ggatggctgt tcccgctctc actcccgcgg ccgtgagggc ctcaggcctc cttggagtga gttggacgtg ggcgctcttt acccctttag tcgctctggg tcgcgagggc ggctcccaag attccgcaac tacgccttcg cgtcctcctg...
Schlagworte: NKAPL, C6orf194, NKAP-like protein
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
450,00 €
Bewerten
Anti-NKAPL, HRP conjugated
Anti-NKAPL, HRP conjugated

Artikelnummer: CSB-PA702797NB01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: NKAPL. Antigen Species: Human
Schlagworte: Anti-NKAPL, Anti-C6orf194, Anti-NKAP-like protein, NKAPL antibody, C6orf194 antibody, NKAP-like protein antibody, NKAPL...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-NKAPL, Biotin conjugated
Anti-NKAPL, Biotin conjugated

Artikelnummer: CSB-PA702797ND01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: NKAPL. Antigen Species: Human
Schlagworte: Anti-NKAPL, Anti-C6orf194, Anti-NKAP-like protein, NKAPL antibody, C6orf194 antibody, NKAP-like protein antibody, NKAPL...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-NKAPL
Anti-NKAPL

Artikelnummer: CSB-PA702797NA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: NKAPL. Antigen Species: Human
Schlagworte: Anti-NKAPL, Anti-C6orf194, Anti-NKAP-like protein, NKAPL antibody, C6orf194 antibody, NKAP-like protein antibody, NKAPL...
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-NKAPL, FITC conjugated
Anti-NKAPL, FITC conjugated

Artikelnummer: CSB-PA702797NC01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: NKAPL. Antigen Species: Human
Schlagworte: Anti-NKAPL, Anti-C6orf194, Anti-NKAP-like protein, NKAPL antibody, C6orf194 antibody, NKAP-like protein antibody, NKAPL...
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
NKAPL (human), recombinant protein
NKAPL (human), recombinant protein

Artikelnummer: ABS-PP-12185.100

Protein function: Transcriptional repressor of Notch-mediated signaling. Required for spermatogenesis. [The UniProt Consortium]
Schlagworte: NKAP-like protein, Recombinant Human NKAPL Protein
Exprimiert in: E.coli
Ursprungsart: human
MW: 17.5 kD
ab 90,00 €
Bewerten
NKAPL PrEST Antigen
NKAPL PrEST Antigen

Artikelnummer: ATA-APrEST96066.100

PrEST Antigen NKAPL, Gene description: NFKB activating protein like, Alternative Gene Names: bA424I5.1, C6orf194, Antigen sequence: KDSEEDLSEATWMEQPNVADTMDLIGPEAPIIHTSQD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Transcriptional repressor of Notch-mediated signaling....
Schlagworte: NKAPL, C6orf194, NKAP-like protein
Exprimiert in: E.coli
Ursprungsart: human
264,00 €
Bewerten