- Suchergebnis für GeneID 215274
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 215274" wurden 13 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
-20 %
Rabattaktion
Artikelnummer: AG-40B-0227-C010
IL-38 (IL-1F10) belongs to the IL-1 family of proteins. IL-38 is expressed in heart, placenta, fetal liver, spleen, thymus and tonsil. The expression in a variety of immune tissues and similarity to IL-1Ra suggest a role of IL-38 in the inflammatory response. It has been reported that removal of the N-terminus...
| Schlagworte: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
| Anwendung: | Bioassays |
| Exprimiert in: | Human cells |
| Ursprungsart: | mouse |
| MW: | ~52+28 kD |
231,00 €
ab 184,80 €
Artikelnummer: CSB-YP837144MO.1
Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 1-152aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MCSLPMARYY IIKDAHQKAL YTRNGQLLLG DPDSDNYSPE KVCILPNRGL DRSKVPIFLG MQGGSCCLAC VKTREGPLLQ LEDVNIEDLY KGGEQTTRFT FFQRSLGSAF RLEAAACPGW FLCGPAEPQQ PVQLTKESEP...
| Schlagworte: | Il1f10, IL-1F10, Interleukin-1 family member 10, Recombinant Mouse Interleukin-1 family member 10 (Il1f10) |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | mouse |
| MW: | 19.1 kD |
ab 407,00 €
Artikelnummer: CSB-EP837144MO.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 1-152aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MCSLPMARYY IIKDAHQKAL YTRNGQLLLG DPDSDNYSPE KVCILPNRGL DRSKVPIFLG MQGGSCCLAC VKTREGPLLQ LEDVNIEDLY KGGEQTTRFT FFQRSLGSAF RLEAAACPGW FLCGPAEPQQ...
| Schlagworte: | Il1f10, IL-1F10, Interleukin-1 family member 10, Recombinant Mouse Interleukin-1 family member 10 (Il1f10) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 33.1 kD |
ab 364,00 €
Artikelnummer: TGM-TMPH-02737-100ug
Description: IL-1F10 Protein, Mouse, Recombinant (His & SUMO) is expressed in E. coli.
| Schlagworte: | Interleukin-1 family member 10, Il1f10 |
| MW: | 33.1 kD |
ab 340,00 €
Artikelnummer: CSB-PA837144ZA01MO.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-Il1f10, Anti-IL-1F10, Anti-Interleukin-1 family member 10, Il1f10 Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Mus musculus (Mouse) |
1.529,00 €
Artikelnummer: ARG82064.96
Protein function: Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic...
| Schlagworte: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
1.118,00 €
Artikelnummer: AG-40B-0101-C010
IL-38 [IL-1F10] (mouse) (aa 3-152) is fused at the C-terminus o a FLAG®-tag. IL-38 (IL-1F10) mRNA is expressed in heart, placenta, fetal liver, spleen, thymus and tonsil. The expression in a variety of immune tissues and similarity to IL-1Ra suggest a role of IL-1F10 in the inflammatory response.
| Schlagworte: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
| Anwendung: | Bioassays |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 20 kD |
ab 352,00 €
Artikelnummer: CSB-PA837144ZA01MO.2
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-Il1f10, Anti-IL-1F10, Anti-Interleukin-1 family member 10, Il1f10 Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Mus musculus (Mouse) |
ab 1.529,00 €
Artikelnummer: VMPS-3073
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Il1f10, Interleukin 1 family, member 10 |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: 373808.20
Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by...
| Schlagworte: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
| MW: | 33,1 |
ab 563,00 €
Artikelnummer: 373809.100
Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by...
| Schlagworte: | Il1f10, IL-1F10, Interleukin-1 family member 10 |
| MW: | 19,1 |
ab 636,00 €
Artikelnummer: E-PKSM041483.100
Sequence: MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR. Fusion tag: N-His Endotoxin: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Protein function: Cytokine with immunomodulatory...
| Schlagworte: | Il1f10, IL-1F10, Interleukin-1 family member 10, Recombinant Mouse IL-38 protein(N-His) |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 17.9 kD |
ab 241,00 €