Zu "GeneID 20284" wurden 11 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Scrapie-responsive protein 1 (Scrg1), mouse, recombinant
Artikelnummer: CSB-YP526023MO.1
Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MPSSRLSCYR KLLKDRNCHN LPEGRADLKL IDANVQHHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNH. Purity: Greater than 90% as determined by...
| Schlagworte: | Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Mouse Scrapie-responsive... |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | mouse |
| MW: | 11 kD |
ab 347,00 €
Scrapie-responsive protein 1 (Scrg1), mouse, recombinant
Artikelnummer: CSB-EP526023MO.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MPSSRLSCYR KLLKDRNCHN LPEGRADLKL IDANVQHHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNH. Purity: Greater than 90% as determined by...
| Schlagworte: | Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Mouse Scrapie-responsive... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 25 kD |
ab 292,00 €
Scrapie-responsive protein 1 (Scrg1), mouse, recombinant
Artikelnummer: CSB-EP526023MOa0.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MPSSRLSCYR KLLKDRNCHN LPEGRADLKL IDANVQHHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNH. Purity: Greater than 85% as determined by...
| Schlagworte: | Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Mouse Scrapie-responsive... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 15.0 kD |
ab 292,00 €
SCRG1 Protein, Mouse, Recombinant (His)
Artikelnummer: TGM-TMPH-02887-10ug
Description: SCRG1 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 15.0 kDa and the accession number is O88745?.
| Schlagworte: | Scrapie-responsive protein 1 , Scrg1 , Scrapie-responsive gene 1 protein |
| MW: | 15 kD |
ab 99,00 €
Scrg1, Mouse scrapie responsive gene 1, Real Time PCR...
Artikelnummer: VMPS-5717
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein |
| Anwendung: | RNA quantification |
45,00 €
Anti-Scrg1
Artikelnummer: G-PACO35130.50
Scrg1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Mouse and for use in ELISA applications. Scrg1 Antibody is a high quality polyclonal antibody for research use only.
| Schlagworte: | Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
313,00 €
Scrg1, Recombinant, Mouse, aa21-98, His-Tag...
Artikelnummer: 375227.100
Source:, Recombinant protein corresponding to aa21-98 from mouse Scrg1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.0kD, AA Sequence: MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot...
| Schlagworte: | Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein |
| MW: | 11 |
ab 636,00 €
Anti-Scrg1, FITC conjugated
Artikelnummer: CSB-PA526023HC01MO.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Scrg1. Antigen Species: Mouse
| Schlagworte: | Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein, Scrg1 antibody,... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
ab 167,00 €
Anti-Scrg1, Biotin conjugated
Artikelnummer: CSB-PA526023HD01MO.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Scrg1. Antigen Species: Mouse
| Schlagworte: | Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein, Scrg1 antibody,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
ab 167,00 €
Anti-Scrg1
Artikelnummer: CSB-PA526023HA01MO.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Scrg1. Antigen Species: Mouse
| Schlagworte: | Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein, Scrg1 antibody,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
ab 167,00 €
Anti-Scrg1, HRP conjugated
Artikelnummer: CSB-PA526023HB01MO.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Scrg1. Antigen Species: Mouse
| Schlagworte: | Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein, Scrg1 antibody,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
ab 167,00 €