Zu "GeneID 20208" wurden 16 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Mouse serum Amyloid A ELISA Kit
Mouse serum Amyloid A ELISA Kit

Artikelnummer: ARG81841.96

Protein function: Major acute phase protein. [The UniProt Consortium]
Schlagworte: Saa1, Serum amyloid A-1 protein
Anwendung: ELISA
Spezies-Reaktivität: mouse
1.118,00 €
Bewerten
Serum amyloid A-1 protein (Saa1), mouse, recombinant
Serum amyloid A-1 protein (Saa1), mouse, recombinant

Artikelnummer: CSB-EP020656MO.1

Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 20-122aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: GFFSFVHEAF QGAGDMWRAY TDMKEANWKN SDKYFHARGN YDAAQRGPGG VWAAEKISDG REAFQEFFGR GHEDTIADQE ANRHGRSGKD PNYYRPPGLP DKY. Purity:...
Schlagworte: Saa1, Serum amyloid A-1 protein, Recombinant Mouse Serum amyloid A-1 protein (Saa1)
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: mouse
MW: 27.8 kD
ab 292,00 €
Bewerten
Serum amyloid A-1 protein (Saa1), mouse, recombinant
Serum amyloid A-1 protein (Saa1), mouse, recombinant

Artikelnummer: CSB-EP020656MOa0.1

Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 20-122aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: GFFSFVHEAF QGAGDMWRAY TDMKEANWKN SDKYFHARGN YDAAQRGPGG VWAAEKISDG REAFQEFFGR GHEDTIADQE ANRHGRSGKD PNYYRPPGLP DKY. Purity: Greater...
Schlagworte: Saa1, Serum amyloid A-1 protein, Recombinant Mouse Serum amyloid A-1 protein (Saa1)
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: mouse
MW: 17 kD
ab 292,00 €
Bewerten
SAA1 Protein, Mouse, Recombinant (His)
SAA1 Protein, Mouse, Recombinant (His)

Artikelnummer: TGM-TMPH-02900-100ug

Description: Major acute phase protein. SAA1 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 17 kDa and the accession number is P05366.
Schlagworte: Serum amyloid A-1 protein, Saa1
MW: 17 kD
ab 266,00 €
Bewerten
NEU
Mouse SAA (Serum Amyloid A) ELISA Kit
Mouse SAA (Serum Amyloid A) ELISA Kit

Artikelnummer: G-AEKE04203.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse SAA. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse SAA. Next,...
Schlagworte: Saa1, Serum amyloid A-1 protein
Anwendung: ELISA
Spezies-Reaktivität: human
694,00 €
Bewerten
NEU
Mouse SAA (Serum Amyloid A ) Superset Max DIY ELISA
Mouse SAA (Serum Amyloid A ) Superset Max DIY ELISA

Artikelnummer: G-AEES05482.480

Mouse SAA (Serum Amyloid A ) Superset Max DIY ELISA Protein Function: Major acute phase protein [The Uniprot Consortium]
Schlagworte: Saa1, Serum amyloid A-1 protein
Anwendung: ELISA
Spezies-Reaktivität: mouse
919,00 €
Bewerten
NEU
SAA1 Protein, Mouse, Recombinant (His)
SAA1 Protein, Mouse, Recombinant (His)

Artikelnummer: TGM-TMPH-02900-10ug

Description: Major acute phase protein. SAA1 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 17 kDa and the accession number is P05366.
Schlagworte: Saa1 , Serum amyloid A-1 protein
MW: 17 kD
ab 99,00 €
Bewerten
Saa1, Recombinant, Mouse, aa20-122, His-SUMO-Tag (Serum Amyloid A-1 Protein)
Saa1, Recombinant, Mouse, aa20-122, His-SUMO-Tag (Serum...

Artikelnummer: 375189.100

Major acute phase protein. Source: Recombinant protein corresponding to aa20-122 from mouse Saa1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~27.8kD, AA Sequence: GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY, Storage and...
Schlagworte: Saa1, Serum amyloid A-1 protein
MW: 27,8
ab 690,00 €
Bewerten
Mouse serum amyloid A1 (SAA1) ELISA kit
Mouse serum amyloid A1 (SAA1) ELISA kit

Artikelnummer: CSB-EL020656MO.48

Sample Types: serum, plasma, tissue homogenates Detection Range: 3.12 ng/ml - 200 ng/ml Sensitivity: 0.78 ng/ml Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Major acute phase protein. [The UniProt Consortium]
Schlagworte: Saa1, Serum amyloid A-1 protein
Anwendung: ELISA, Sandwich ELISA
Spezies-Reaktivität: mouse
ab 581,00 €
Bewerten
Mouse SAA(Serum Amyloid A) ELISA Kit
Mouse SAA(Serum Amyloid A) ELISA Kit

Artikelnummer: ELK-ELK10304.48

Major acute phase protein Assay Type: Sandwich. Sensitivity: 2.67 ng/mL. Standard: 500 ng/mL. Detection range: 7.81-500 ng/mL. Sample type: serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. Assay length: 3.5h. Research Field: Infection immunity,Kidney...
Schlagworte: Saa1, Serum amyloid A-1 protein
Anwendung: ELISA
Spezies-Reaktivität: mouse
ab 374,00 €
Bewerten
Serum Amyloid A (SAA) BioAssay(TM) ELISA Kit (Mouse)
Serum Amyloid A (SAA) BioAssay(TM) ELISA Kit (Mouse)

Artikelnummer: 517642.96

Specificity:, This assay has high sensitivity and excellent specificity for detection of Serum Amyloid A (SAA). No significant cross-reactivity or interference between Serum Amyloid A (SAA) and analogues was observed. Precision: Intra-Assay: CV<10% , Inter-Assay: CV<12%, Kit Components: 96-well strip plate, 1x Plate...
Schlagworte: Saa1, Serum amyloid A-1 protein
Anwendung: ELISA
Spezies-Reaktivität: mouse
1.065,00 €
Bewerten
Mouse SAA ELISA Kit
Mouse SAA ELISA Kit

Artikelnummer: KOA0689

Natural and recombinant mouse SAA. There is no detectable cross-reactivity with other relevant proteins. Serum amyloid A protein(SAA), also known as SAA1, is a protein that in humans is encoded by the SAA1 gene. This gene encodes a member of the serum amyloid A family of apolipoproteins. It is mapped to 11p15.1. SAA...
Schlagworte: Saa1, Serum amyloid A-1 protein
Anwendung: ELISA
Wirt: Mouse
Spezies-Reaktivität: mouse
1.030,00 €
Bewerten
1 von 2 Seiten