- Suchergebnis für GeneID 20208
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 20208" wurden 16 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ARG81841.96
Protein function: Major acute phase protein. [The UniProt Consortium]
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
1.118,00 €
Artikelnummer: CSB-EP020656MO.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 20-122aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: GFFSFVHEAF QGAGDMWRAY TDMKEANWKN SDKYFHARGN YDAAQRGPGG VWAAEKISDG REAFQEFFGR GHEDTIADQE ANRHGRSGKD PNYYRPPGLP DKY. Purity:...
| Schlagworte: | Saa1, Serum amyloid A-1 protein, Recombinant Mouse Serum amyloid A-1 protein (Saa1) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 27.8 kD |
ab 292,00 €
Artikelnummer: CSB-EP020656MOa0.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 20-122aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: GFFSFVHEAF QGAGDMWRAY TDMKEANWKN SDKYFHARGN YDAAQRGPGG VWAAEKISDG REAFQEFFGR GHEDTIADQE ANRHGRSGKD PNYYRPPGLP DKY. Purity: Greater...
| Schlagworte: | Saa1, Serum amyloid A-1 protein, Recombinant Mouse Serum amyloid A-1 protein (Saa1) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 17 kD |
ab 292,00 €
Artikelnummer: TGM-TMPH-02900-100ug
Description: Major acute phase protein. SAA1 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 17 kDa and the accession number is P05366.
| Schlagworte: | Serum amyloid A-1 protein, Saa1 |
| MW: | 17 kD |
ab 266,00 €
NEU
Artikelnummer: G-AEKE04203.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse SAA. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse SAA. Next,...
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | human |
694,00 €
NEU
Artikelnummer: G-AEES05482.480
Mouse SAA (Serum Amyloid A ) Superset Max DIY ELISA Protein Function: Major acute phase protein [The Uniprot Consortium]
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
919,00 €
NEU
Artikelnummer: TGM-TMPH-02900-10ug
Description: Major acute phase protein. SAA1 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 17 kDa and the accession number is P05366.
| Schlagworte: | Saa1 , Serum amyloid A-1 protein |
| MW: | 17 kD |
ab 99,00 €
Artikelnummer: 375189.100
Major acute phase protein. Source: Recombinant protein corresponding to aa20-122 from mouse Saa1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~27.8kD, AA Sequence: GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY, Storage and...
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| MW: | 27,8 |
ab 690,00 €
Artikelnummer: CSB-EL020656MO.48
Sample Types: serum, plasma, tissue homogenates Detection Range: 3.12 ng/ml - 200 ng/ml Sensitivity: 0.78 ng/ml Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Major acute phase protein. [The UniProt Consortium]
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | ELISA, Sandwich ELISA |
| Spezies-Reaktivität: | mouse |
ab 581,00 €
Artikelnummer: ELK-ELK10304.48
Major acute phase protein Assay Type: Sandwich. Sensitivity: 2.67 ng/mL. Standard: 500 ng/mL. Detection range: 7.81-500 ng/mL. Sample type: serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. Assay length: 3.5h. Research Field: Infection immunity,Kidney...
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
ab 374,00 €
Artikelnummer: 517642.96
Specificity:, This assay has high sensitivity and excellent specificity for detection of Serum Amyloid A (SAA). No significant cross-reactivity or interference between Serum Amyloid A (SAA) and analogues was observed. Precision: Intra-Assay: CV<10% , Inter-Assay: CV<12%, Kit Components: 96-well strip plate, 1x Plate...
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | mouse |
1.065,00 €
Artikelnummer: KOA0689
Natural and recombinant mouse SAA. There is no detectable cross-reactivity with other relevant proteins. Serum amyloid A protein(SAA), also known as SAA1, is a protein that in humans is encoded by the SAA1 gene. This gene encodes a member of the serum amyloid A family of apolipoproteins. It is mapped to 11p15.1. SAA...
| Schlagworte: | Saa1, Serum amyloid A-1 protein |
| Anwendung: | ELISA |
| Wirt: | Mouse |
| Spezies-Reaktivität: | mouse |
1.030,00 €